KEGG   Desmodus rotundus (common vampire bat): 112320588
Entry
112320588         CDS       T05907                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro00230  Purine metabolism
dro00240  Pyrimidine metabolism
dro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112320588 (DCK)
   00240 Pyrimidine metabolism
    112320588 (DCK)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     112320588 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_28 tRNA_lig_kinase AAA_18 AAA_33
Other DBs
NCBI-GeneID: 112320588
NCBI-ProteinID: XP_024433847
Position
Unknown
AA seq 241 aa
MNWILVQLSTLGAGKTTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEIQELTTSQRSGG
NVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAEKPVVFFERSVYSDRYIFAS
NLYESDCMNETEWTIYQDWHDWMNKQFGQSLELDGIIYLRATPEKCLSRIYFRGRNEEQG
IPLEYLEKLHSKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKHDSLVEKVKEFLST
L
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaactggatattagtccaattgagcactctaggtgcaggaaagacaacatttgtgaat
atccttaagcaactctgtgaggattgggaagtggttcctgaacctgttgccagatggtgc
aatgttcaaagtactcaagatgaaattcaggaattgacaacatctcagagaagtggtggg
aatgtccttcagatgatgtatgagaaacctgagcgatggtcttttaccttccagtcatat
gcctgcctcagtcggatacgagctcagcttgctgctctgaatggcaaactcaaagacgcg
gagaaacctgtagtattttttgagcgatctgtatatagtgacaggtatatttttgcatct
aatttgtatgaatctgattgtatgaatgaaacagagtggacaatttatcaagactggcat
gactggatgaataagcagtttggacaaagccttgaactggatggaatcatttatcttcga
gccactccagagaaatgcttgagcagaatatattttcggggaagaaatgaagagcaaggc
attcctcttgaatatttagagaagcttcactctaagcatgagagctggctcctgcataga
acactaaaaaccaactttgattatctacaagaagtgcctatcttaaccctggatgttaat
gaagactttaaagacaaacatgacagtctggttgaaaaggtcaaagaatttctgagcact
ttgtga

DBGET integrated database retrieval system