KEGG   Desmodus rotundus (common vampire bat): 112321125
Entry
112321125         CDS       T05907                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112321125 (AHRR)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112321125 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 112321125
NCBI-ProteinID: XP_024434345
Position
Unknown
AA seq 708 aa
MIPPGECMYAGRKRRKPVQKQKPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPDVVSK
LDKLSVLRLSVSYLRVKSFFQAVQEKCPLRPAVSAPSPGASGPHGGSAVLEGRLLLESLD
GFALVVSAEGVIFYASATIADYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQA
VCGQPLHSETGEDAVLGRLLRAQEGATGPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQ
GKLKFLFGQKRKAPSGTVLSPRLSLFCVVVPVLLPAVAEMKMKGAFLRAKHRTDISATMD
TKAKATRSLCVSELHGKPNYLAGRNNGENGISVFRAQMDACCWARVPARATCLCLRGGPD
LVLYPEGAAGDWGGEEPRRVPGGSSGVRRRRRETHAYDCCFETPGPMRQLNWATGKHAQD
GTKLKLESSRSDPFSVHAMSRGSCLPYPGTPGTVPAFRNSPGSQQSPSAYTSQPSRALRD
GDQGQVHPPTSCPFPQGSLENQLSQPGVQCLAAGGYSTEDIKLPGVPMPLEAPCNPMLSL
NVPIKMESDSGSEDATDGYSVSPSQVWLGTSDVAKRQLVTFPTRMHLKTEPDSKHHLYPL
HLEHGMLGAPPRPGRELAPFHPAHFVCLERGHGPPEPEPPPCLCMRGRRPPTLGCDCRAP
GTTPMIKLEPLDSPPWAAHSQGGVPRMLPRSALATLVPPKASECSFLP
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgatcccgccaggggagtgcatgtatgccggcaggaaaagaaggaagcccgtccagaaa
cagaagcccgctgtgggggctgagaagtcgaacccttccaagcggcaccgagaccgcctc
aatgccgagctggaccatctggccagcctgctgccgttcccaccggacgtggtctctaag
ctggacaagctctcagtcttgcgtctcagcgtcagttacctcagggtgaagagcttcttc
caagccgtgcaggagaagtgcccactgcgaccggcagtcagtgccccctcaccaggagcc
agcggtcctcacggaggctcagccgtgctggagggaaggttgctgctggagtccctggat
ggctttgctctggtcgtgagtgcagaaggggtgatattttatgcgtcagccacaattgca
gactacctgggcttccaccagacggatgtgatgcaccaaaacatttatgactacatccac
gtggacgaccgccaggacttctgccggcagctgcactgggccatggaccctccccaggcg
gtgtgtgggcagcccctgcactcggagacaggagaggatgctgtcctgggaaggcttctc
agagcccaggagggggccacgggccccaccgagtactctgccttcctgacgcgctgcttc
atctgtcgagtacgctgcctgctggacagcacctcaggcttcctgacaatgcagtttcaa
ggaaaactaaaattcctgtttggacagaagagaaaggccccatcagggacagtcctgtcc
cctcggctctcactgttctgcgtcgtggtacccgtcctcctacctgctgtggcagagatg
aaaatgaagggtgcattcttgagggcgaagcacaggacggacatctcagccacgatggac
acaaaagcaaaagccaccaggagtctgtgtgtgtcagaactgcatggaaaacccaattac
ttagcagggagaaacaatggagaaaatggcatttcagtgttcagggcacagatggatgcc
tgctgctgggcccgggttccagccagggccacatgtctgtgcctcaggggtggccccgac
ctcgtcctttaccccgagggggctgcaggggactggggaggagaggagcccaggagggtg
ccaggcggttcctctggggtgaggaggagaaggcgggaaacacacgcatatgactgctgc
tttgagacgccaggacccatgaggcagctgaactgggcgacagggaaacatgctcaggat
ggcaccaagctgaagctggagtctagcaggagtgacccgttctccgtgcatgccatgtcc
cggggctcctgcctgccctaccccggcaccccgggcactgtccctgccttcaggaactca
cctggctcacagcagtcccccagtgcgtacaccagccagccaagcagagccttgcgggat
ggtgatcagggccaagtacacccccccaccagctgccccttcccccaggggagcctggag
aaccagctctcccagcctggagtacaatgtctcgcagcagggggctactccaccgaggac
atcaagttgccaggtgtgcccatgcccctggaggccccatgcaaccccatgttgtcactc
aatgtacccatcaagatggagagtgactctgggtccgaggatgcaacagatggctactct
gtgtccccaagccaggtgtggctgggaaccagtgatgtggccaagagacagctggtcact
ttccctaccaggatgcacttaaaaacagagccagactccaagcaccacctgtaccccctg
cacctggagcatggcatgctgggggctccccccaggcctggcagggagctggccccattc
catcctgcacatttcgtctgcctggagcgtggccatggccctccagagccagagcctccc
ccctgcctctgtatgcgcggccgccggccccccactctgggctgtgactgcagagctccc
gggaccacacccatgatcaagcttgagcccttggactcccctccatgggctgctcacagc
cagggtggggtgcccagaatgctccccagaagtgccttggcaacactggtgcctcccaaa
gcctctgaatgctcttttctgccatag

DBGET integrated database retrieval system