KEGG   Desmodus rotundus (common vampire bat): 112321325
Entry
112321325         CDS       T05907                                 

Gene name
BTK
Definition
(RefSeq) tyrosine-protein kinase BTK
  KO
K07370  Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04064  NF-kappa B signaling pathway
dro04380  Osteoclast differentiation
dro04611  Platelet activation
dro04662  B cell receptor signaling pathway
dro04664  Fc epsilon RI signaling pathway
dro05169  Epstein-Barr virus infection
dro05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112321325 (BTK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112321325 (BTK)
   04662 B cell receptor signaling pathway
    112321325 (BTK)
   04664 Fc epsilon RI signaling pathway
    112321325 (BTK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112321325 (BTK)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    112321325 (BTK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    112321325 (BTK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112321325 (BTK)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112321325 (BTK)
Protein kinases [BR:dro01001]
 Non-receptor tyrosine kinases
  TEC family
   112321325 (BTK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_2 Kinase-like SH3_3 SH3_10 Pkinase_fungal Kdo APH SH3_4
Other DBs
NCBI-GeneID: 112321325
NCBI-ProteinID: XP_024434497
Position
Unknown
AA seq 659 aa
MATVILESIFLKRSQQKKKTSPLNFKKRLFLLTMHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESGEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAAPVSTSELKKVVALYDYMPMNANDLQLQKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEELLKQEGK
EGGFIVRDSSKAGKYTVSVYAKSAGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHHFQSQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKADERPTFKVLLSNILDVMDEES
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggctacagtgatactggagagcatctttctgaagcgatcccagcagaaaaagaaaaca
tcacctttaaacttcaagaagcgcctctttctcctgaccatgcacaaactttcctactat
gagtatgattttgaacgtggaagaagaggcagtaagaagggttcaatagatgttgagaag
atcacctgcgttgaaacagtggttcctgaaaaaaatcctccccctgaaagacagattccg
cgaaggggtgaagagtctggtgaaatggagcagatctcaatcattgaaaggtttccttac
cccttccaggttgtatatgatgaagggccactctatgtcttctccccaacagaagaactg
aggaaacgttggattcaccagctcaaaaatgtaatccggtataacagtgatctggtacag
aaataccacccttgcttctggattgatgggcagtatctctgctgctctcagacagccaaa
aatgctatgggctgccaaattttggagaacaggaatggaagcttgaaacctgggagttct
caccggaagacaaaaaagcctcttcctcccacacctgaggaggaccagatcttgaaaaag
ccactgcctcctgaaccaacagcagcaccagtctccacaagtgaacttaaaaaggttgta
gccctttatgattacatgccaatgaatgcaaatgatctacagctgcagaaaggtgatgaa
tattttatcctggaggagagcaacttaccctggtggcgagcacgagataaaaatgggcag
gaaggctacatccctagtaactacgtcaccgaagcagaagactccatagaaatgtatgag
tggtattccaagcacatgactcggagtcaagctgaagaactgctgaagcaggaggggaag
gaaggtggtttcattgtcagagactccagcaaagctggaaaatatactgtgtctgtgtat
gctaaatctgcaggggaccctcaaggggtgatacgccattatgttgtgtgttccacacct
caaagccagtattacctggctgagaagcatctcttcagcaccatccctgagctcattaac
taccatcagcataactctgcagggctcatatctaggctcaaatatccagtgtctcaacaa
aacaagaatgcgccttctactgcaggcctgggctacggatcatgggaaattgatccaaag
gacctgaccttcttgaaggagctggggactggacaatttggagtagtgaagtatgggaaa
tggagaggccagtatgatgtggccatcaagatgatcaaagaaggctccatgtctgaggat
gagttcattgaagaagcgaaagtcatgatgaatctttcccatgagaagctggtacagttg
tacggtgtctgcaccaaacagcgccccatcttcatcatcactgagtacatggccaatggc
tgcctactcaactacctgagggagatgcgccaccacttccagagtcagcaactgctggag
atgtgcaaggatgtttgcgaagccatggaatacctggagtcaaagcagttcctccacaga
gacctggcagctcgaaattgtttggtaaacgatcaaggagttgttaaagtatctgacttt
ggcctgtccaggtatgttctggatgatgaatacacaagctcagtgggctccaaatttcca
gtccggtggtctccaccagaagtgcttatgtacagcaagttcagcagtaaatctgacatt
tgggcttttggggttttgatgtgggaaatttactctctggggaaaatgccatatgagaga
tttactaacagtgaaactgctgaacacattgcccaaggcctgcgtctctacaggcctcat
ctagcttctgagcgggtatataccatcatgtacagctgctggcatgagaaagcagatgaa
cgtcccactttcaaagttcttctgagtaacatcctagatgtcatggatgaagaatcctga

DBGET integrated database retrieval system