KEGG   Desmodus rotundus (common vampire bat): 112321547
Entry
112321547         CDS       T05907                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X1
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro01523  Antifolate resistance
dro04010  MAPK signaling pathway
dro04014  Ras signaling pathway
dro04062  Chemokine signaling pathway
dro04064  NF-kappa B signaling pathway
dro04068  FoxO signaling pathway
dro04150  mTOR signaling pathway
dro04151  PI3K-Akt signaling pathway
dro04210  Apoptosis
dro04380  Osteoclast differentiation
dro04620  Toll-like receptor signaling pathway
dro04621  NOD-like receptor signaling pathway
dro04622  RIG-I-like receptor signaling pathway
dro04623  Cytosolic DNA-sensing pathway
dro04625  C-type lectin receptor signaling pathway
dro04657  IL-17 signaling pathway
dro04658  Th1 and Th2 cell differentiation
dro04659  Th17 cell differentiation
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro04668  TNF signaling pathway
dro04722  Neurotrophin signaling pathway
dro04910  Insulin signaling pathway
dro04920  Adipocytokine signaling pathway
dro04930  Type II diabetes mellitus
dro04931  Insulin resistance
dro04932  Non-alcoholic fatty liver disease
dro05010  Alzheimer disease
dro05132  Salmonella infection
dro05135  Yersinia infection
dro05142  Chagas disease
dro05145  Toxoplasmosis
dro05160  Hepatitis C
dro05161  Hepatitis B
dro05162  Measles
dro05163  Human cytomegalovirus infection
dro05164  Influenza A
dro05165  Human papillomavirus infection
dro05166  Human T-cell leukemia virus 1 infection
dro05167  Kaposi sarcoma-associated herpesvirus infection
dro05168  Herpes simplex virus 1 infection
dro05169  Epstein-Barr virus infection
dro05170  Human immunodeficiency virus 1 infection
dro05200  Pathways in cancer
dro05206  MicroRNAs in cancer
dro05212  Pancreatic cancer
dro05215  Prostate cancer
dro05220  Chronic myeloid leukemia
dro05221  Acute myeloid leukemia
dro05222  Small cell lung cancer
dro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112321547 (IKBKB)
   04014 Ras signaling pathway
    112321547 (IKBKB)
   04064 NF-kappa B signaling pathway
    112321547 (IKBKB)
   04668 TNF signaling pathway
    112321547 (IKBKB)
   04068 FoxO signaling pathway
    112321547 (IKBKB)
   04151 PI3K-Akt signaling pathway
    112321547 (IKBKB)
   04150 mTOR signaling pathway
    112321547 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112321547 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112321547 (IKBKB)
   04621 NOD-like receptor signaling pathway
    112321547 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    112321547 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    112321547 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    112321547 (IKBKB)
   04660 T cell receptor signaling pathway
    112321547 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    112321547 (IKBKB)
   04659 Th17 cell differentiation
    112321547 (IKBKB)
   04657 IL-17 signaling pathway
    112321547 (IKBKB)
   04662 B cell receptor signaling pathway
    112321547 (IKBKB)
   04062 Chemokine signaling pathway
    112321547 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112321547 (IKBKB)
   04920 Adipocytokine signaling pathway
    112321547 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112321547 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112321547 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112321547 (IKBKB)
   05206 MicroRNAs in cancer
    112321547 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112321547 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112321547 (IKBKB)
   05221 Acute myeloid leukemia
    112321547 (IKBKB)
   05220 Chronic myeloid leukemia
    112321547 (IKBKB)
   05215 Prostate cancer
    112321547 (IKBKB)
   05222 Small cell lung cancer
    112321547 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112321547 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112321547 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112321547 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    112321547 (IKBKB)
   04931 Insulin resistance
    112321547 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112321547 (IKBKB)
   05135 Yersinia infection
    112321547 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112321547 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    112321547 (IKBKB)
   05162 Measles
    112321547 (IKBKB)
   05164 Influenza A
    112321547 (IKBKB)
   05161 Hepatitis B
    112321547 (IKBKB)
   05160 Hepatitis C
    112321547 (IKBKB)
   05168 Herpes simplex virus 1 infection
    112321547 (IKBKB)
   05163 Human cytomegalovirus infection
    112321547 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112321547 (IKBKB)
   05169 Epstein-Barr virus infection
    112321547 (IKBKB)
   05165 Human papillomavirus infection
    112321547 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112321547 (IKBKB)
   05142 Chagas disease
    112321547 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    112321547 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dro01001]
    112321547 (IKBKB)
Enzymes [BR:dro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     112321547 (IKBKB)
Protein kinases [BR:dro01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   112321547 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Med20 Glyco_hydro_65m TBK1_ULD
Other DBs
NCBI-GeneID: 112321547
NCBI-ProteinID: XP_024434750
Position
Unknown
AA seq 773 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLSGAVKFASSLPYPNNLNSVLAQRLEKWLQLMLMWHPRQRGTDPVYGPNGCF
KALDDILNLKLVHILNMVTGTTHTYPVSEDESLQSLKARIQQDTGIPEEDQELLQEAGLA
LIPDKPATQCISDGKLNEGRTLDIDLVFLFDNSKVTYETQISPRPQPESVSCILQEPKRN
LSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQA
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHSGQLMSQPPAAPDCLPESVSKSDALVAEAHTLCTQLE
SAMQDTVKEQDQSLRVMAWVNPSYSVSSLQQMRERKWKGDPLVPRSQYTLRVF
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgccaacacagacatgtggggcctgggaaatgaaagaacga
cttgggacagggggatttggaaacgtcatccgatggcacaatcaggaaacaggtgagcag
attgctatcaagcaatgccggcaggagctcagcccccggaatcgagagcggtggtgtctg
gagatccagatcatgagaaggctcaaccaccccaatgtggtggctgcccgggatgtcccc
gaggggatgcagaacttggctcccaacgacttgcccctgctggccatggagtactgccaa
ggaggagatctccgaaagtacctgaaccagtttgagaactgctgtggcctacgggaagga
gccatcctcaccttgctgagtgacattgcctctgcgcttcgatatcttcatgaaaacaga
atcatccatcgggatctcaagcccgaaaacatcgtgctgcagcaaggagagcaaagatta
atacacaaaattattgacctaggatatgccaaggaactggatcagggcagtctctgtact
tcctttgtggggaccctgcagtacctggccccagaactgctggagcagcaaaagtacaca
gtgaccgtcgactactggagctttggcaccttggctttcgagtgcatcactggcttccgg
cctttcctccctaactggcagcctgtgcagtggcactccaaagtccggcagaagagtgag
atggacatcgtggtgtctgaagacttgagcggagcagtgaagtttgcaagctctttaccc
taccccaataaccttaacagcgtcctggcgcagcgactggagaagtggctgcagctgatg
ctgatgtggcacccccgacaaaggggcactgatcccgtgtatgggcccaacggctgcttc
aaggccctggatgacatactaaacctaaagctggttcatatcttgaacatggtcacaggc
accactcacacctatccagtgtcagaggacgagagtctacagagcttaaaggccagaatc
cagcaggacacaggaatccccgaggaggaccaggagctgctgcaagaagcgggtctggcg
ttgatccccgacaagcctgccactcagtgtatttcagatggcaagctaaacgagggccgc
acactggacatagatctcgtttttctcttcgacaacagtaaagtcacctatgagactcag
atctctccacggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaac
ctgtctttcttccagctgcggaaagtatggggccaggtttggcacagcatccaaaccctg
aaggaggactgtaaccggctgcagcagggacagcgagctgccatgatgaatctcctgcgg
aacaacagctgcctctccaagatgaagaattccatggcctccatgtctcagcagctcaag
gccaagttggatttctttaagaccagcatccagattgacctggagaagtatagtgagcaa
actgagtttgggatcacatcagataaactgctgctggcctggagggaaatggaacaggcc
gtggagctctgtgggcgggagaacgaagtgaaacatctggtggagcggatgatggcgctg
cagacggacattgtggacttgcagagaagcccgatgggtcggaagcagggcgggacgctg
gatgacctagaagagcaagcaagggagctttacaggagactcagggaaaaaccaagagac
caacgaaccgagggggacagtcaggaaatggtgcgactgctgcttcaggccatccaagcc
tttgagaagaaagtgcgagtgatctacacgcagctcagtaaaactgtggtttgcaagcag
aaggctctggaattgttgcccaaggtggaagaggtggtgagtttaatgaatgaggacgag
aagactgttgttcggcttcaggaaaagcggcagaaggagctctggaatctcctgaagatc
gcgtgtagcaaggtccgtggtcctgttagtggaagcccagacagcatgaatgcttctcgc
cttagtcactctggtcagctcatgtctcagcctcccgctgcccctgactgcttacctgag
tcggtcagcaaaagtgacgcactggtggctgaagcacatactctctgcacccagctagaa
agcgcgatgcaagacaccgtgaaagaacaggaccagagtttacgggtaatggcctgggtg
aaccccagctattccgtgtcctctctacagcagatgagagaaagaaaatggaaaggcgat
ccattggttcctcgatctcagtatacacttagggttttctag

DBGET integrated database retrieval system