KEGG   Desmodus rotundus (common vampire bat): 112322438
Entry
112322438         CDS       T05907                                 

Gene name
CLOCK
Definition
(RefSeq) circadian locomoter output cycles protein kaput
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04710  Circadian rhythm
dro04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:dro00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    112322438 (CLOCK)
  09159 Environmental adaptation
   04710 Circadian rhythm
    112322438 (CLOCK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dro03000]
    112322438 (CLOCK)
   03036 Chromosome and associated proteins [BR:dro03036]
    112322438 (CLOCK)
Enzymes [BR:dro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     112322438 (CLOCK)
Transcription factors [BR:dro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112322438 (CLOCK)
Chromosome and associated proteins [BR:dro03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    112322438 (CLOCK)
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9
Other DBs
NCBI-GeneID: 112322438
NCBI-ProteinID: XP_024435789
Position
Unknown
AA seq 856 aa
MLFTVSCSKMSSIVDRDDGSLFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNNVSTSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAISDPSSTPTKIPTDTSTPPRQHLPAHDKMAQRRSSF
SSQSINSQSIGQSLTQPVMSQATNLPVPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQNQ
VVQTNQIQSGMNTGHIGTTQHMMPQHTIQSASSQSQQNVLSGHSQQTSLPSQTQSTLTAP
LYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVAC
GAVMVPSTMLMGQVVTAYPTFAAQQQQSQTLSVTQQQQQQQQQQQQQQQQSSQEQQLTSV
QQPSQAQLSQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLS
RHRTDALTDPSKIQPQ
NT seq 2571 nt   +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgttgacagagatgatggtagt
ctttttgatggattggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaattgggatccatg
cttcctggtaatgctagaaagatggacaagtctaccgttctgcagaagagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagtataatatatgtgtctgagagtgtaacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagag
ggtgaacattcagaggtttataaaatactttctacccatctgctggaaagtgactcatta
acccccgaatatttaaaatcaaaaaatcaattagaattttgttgtcatatgcttcgagga
acaatagacccaaaggagccatctacctatgaatatgtgaaatttatcggaaatttcaaa
tctttaaacaatgtatctacttcagcgcacaatggttttgaaggaactatacaacgcaca
cacaggccttcttatgaagatagagtttgttttgtagctactgtcagattagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacccaatgaagagtttacatctagacat
agtttagaatggaaatttctatttctcgatcacagggcaccacccataataggatatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ttggcaaaatgtcatgagcacttgatgcaatatgggaaaggcaaatcatgttattacagg
ttcctgaccaaaggacaacagtggatttggcttcaaactcattattatatcacttatcat
cagtggaattcaagaccagagtttattgtttgtactcacactgtagtaagttacgcagaa
gttagggctgaaagacgacgagaacttggcattgaagaatctcttcctgaaacagctgct
gacaaaagccaagattctgggtctgataatcgtataaacacagtcagtctcaaggaagca
ttggaaaggtttgatcacagcccaaccccttctgcttcctcccggagttcaagaaaatca
tctcacaccgcaatctcagacccttcttcaacaccaacgaagatcccaacggataccagc
actcctcccagacagcatttaccagctcatgacaagatggcacaaaggaggtcatcattt
agtagtcagtcaataaattcccagtctattggtcaatcattaacacagccagtgatgtct
caagccacaaatttaccagttccacaaggcatgtcccagtttcagttttcagcacaatta
ggagcgatgcagcatctaaaagaccaattggagcaacggacacgaatgatagaggcaaat
attcatcggcaacaagaagaactaagaaaaattcaagaacaacttcagatggtccatggt
caagggctgcagatgtttttacaacaatcaaaccctgggttgaattttggttctgttcaa
ctttcttccggaaattcatctaacatccagcaactcgcacctataaatatgcaaaaccag
gttgttcaaactaaccagattcaaagtggaatgaataccggacacatcggcacaactcag
cacatgatgccacagcacactatacagagtgcatcaagtcagagtcaacagaatgtactg
agtgggcacagtcaacaaacatctcttcctagtcagacacagagcactcttacagcacca
ctgtataacaccatggtgatctcgcagccagcagccggaagcatggtccagattccgtcg
agcatgccgcaaaacagcacccagagtgctgcagttactacgttcactcaggacagacag
ataagattttcccaaggtcagcaacttgtgaccaaattagtaactgctcctgtagcttgc
ggggcggtcatggtacctagcactatgcttatgggtcaggtggtgactgcctacccaact
tttgctgcacaacagcagcagtcacagacactgtcagtcacgcagcagcagcagcagcag
caacagcagcagcagcagcagcagcagcagagttcccaggaacagcagcttacatcagtt
cagcaaccatctcaggctcagctgtcccaaccaccgcagcaattcttacagacttctagg
ttgctccatgggaacccatcgactcagcttatcctttctgctgcatttccactacaacag
agcactttccctcaatcacatcaccagcaacaccagtctcagcagcaacagcaactgagt
cggcacaggactgacgctttgaccgatccttccaagattcaaccgcagtag

DBGET integrated database retrieval system