KEGG   Desmodus rotundus (common vampire bat): 112322863
Entry
112322863         CDS       T05907                                 

Gene name
MALT1
Definition
(RefSeq) mucosa-associated lymphoid tissue lymphoma translocation protein 1
  KO
K07369  mucosa-associated lymphoid tissue lymphoma translocation protein 1 [EC:3.4.22.-]
Organism
dro  Desmodus rotundus (common vampire bat)
Pathway
dro04064  NF-kappa B signaling pathway
dro04625  C-type lectin receptor signaling pathway
dro04660  T cell receptor signaling pathway
dro04662  B cell receptor signaling pathway
dro05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:dro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112322863 (MALT1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    112322863 (MALT1)
   04660 T cell receptor signaling pathway
    112322863 (MALT1)
   04662 B cell receptor signaling pathway
    112322863 (MALT1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112322863 (MALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dro01002]
    112322863 (MALT1)
Enzymes [BR:dro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     112322863 (MALT1)
Peptidases and inhibitors [BR:dro01002]
 Cysteine peptidases
  Family C14: caspase family
   112322863 (MALT1)
SSDB
Motif
Pfam: MALT1_Ig Ig_2 Ig_3 Peptidase_C14 ig I-set Ig_5 V-set Ig_4 Ig_6 Trehalose_PPase
Other DBs
NCBI-GeneID: 112322863
NCBI-ProteinID: XP_024436293
Position
Unknown
AA seq 787 aa
TINRLPEPLLRRLSGSLDRAPEGRGWRRLAEVAGSRGRLRLSCLDLEQCSLKVLEPEGSP
SLCLLKLLGEKGCTVTELSDFLQALEHTGVLQLLSPPGIKITVNPESKAVLAGQFVKLCC
RATGHPFVQYQWFKMNKEIPNGNASELIFNTVHVKDAGFYVCRVNNNCTFEFSQWSQLDV
CDVTELTESLQGSLDVISESKLQICVEPRSQKLMPGSTLVLQCVAVGSPIPHYQWFRNES
LLAHETKKIYMVPYVDLEHQGTYWCRVYNDRDSQDSKKVEIIVDELHHLGHPDNKEQTAE
QPLAKDKVALLIGNMNYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVD
EFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGL
NVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLK
DRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGAAHSAESLVR
NLQWAKAHELPESLCLKFQCGVQVQLGFAAEFSNVMVIYTSIVHKPPDVTVCDAYVTDFP
LDLDIDPKDANKGTPEETGSYLVSKELPKHCLYTRLGSLQKLKEQLIFTVCLSYQYSGLE
DTIEEKQEVNVGKPLIAKLDIHRGLGRNACFQTCVMCNGPYQSSASPSAGLYRPSQDSFL
GVYHSHLGNSSSVPPSDSCHCSRTADAFISSHRTHQYSSPFGRSNVPVETTDEIPFSFSD
GLRISEK
NT seq 2364 nt   +upstreamnt  +downstreamnt
accatcaaccgtcttccggagccgctgctgcggaggctcagcgggagcttggaccgagcg
ccggagggccggggctggaggaggctggccgaggttgcggggagtcgggggcgcctccgg
ctaagttgcctggacttggagcagtgttctcttaaggtcttggagcccgaagggagcccg
agcctgtgtctgctgaagctcctgggtgagaagggctgcaccgtcacggagctgagtgac
ttcctgcaggccctggagcacactggcgttcttcagctcctcagccccccaggaataaag
atcactgtaaacccagaatcaaaggcagtcttggctggacagtttgtgaaactctgttgc
cgggcaactggacatccttttgtacagtatcaatggttcaaaatgaataaagagattcca
aacggaaatgcatcagaacttatttttaacacagtgcatgtaaaagatgctggcttttat
gtctgtcgcgtcaataataactgcaccttcgaattcagccagtggtcacagctggatgtg
tgtgatgtcacagaattaacagaaagcctccagggaagtttggatgtcatctctgaatcc
aagttgcaaatatgtgttgaaccaaggtcccaaaagctgatgccaggcagcacgctggtc
ctacagtgcgttgctgttggaagccctattcctcactaccagtggttcagaaacgaatct
ctgttagcacacgagacgaaaaagatatacatggtaccttatgtggatttggaacaccaa
ggaacctactggtgtcgtgtgtataatgatcgagacagtcaagacagcaagaaggtagaa
atcatcgtagatgaactccatcatcttgggcatcctgacaataaagagcaaacagctgaa
caacctttggcaaaggacaaggttgctcttttgataggaaatatgaactactgggagcac
cccaagcttaaagcccctttggtggacgtgtatgaactgaccaacttgctaagacagctg
gatttcaaagtcgtctccctgttggatctgactgaatatgagatgcgtaatgctgtggat
gaatttttactacttttagacaaaggagtatatggattattatattatgcgggacatggt
tatgaaaactttgggaacagcttcatggtccctgttgatgctccaaatccatataggtct
gaaaattgtctgtgtgtgcaaaatatactgaaattgatgcaagaaaaagaaaccggactc
aacgtgttcttgttggatatgtgtaggaaaagaaatgactatgatgataccattcccatc
ttggacgcgctgaaagtcactgccaacattgtatttggatatgccacgtgtcaaggagca
gaagcttttgaaatccagcattctggattggcaaatggaatctttatgaaatttttaaaa
gatagattattagaagacaagaaaattactgtgttactggatgaagttgcagaagatatg
ggtaaatgtcatctcaccaaaggcaagcaggctctcgagatccgaagtagcttatcggaa
aagagagcactgactgaccccatacagggagcagcgcattctgcagagtctctggtgcgc
aacctgcagtgggccaaggcacacgaacttccggaaagcctgtgtctgaagtttcagtgt
ggtgtgcaggttcagttggggttcgcggctgagttctccaacgtcatggtgatctacacc
agcatagtgcacaagccacccgatgtaaccgtgtgcgatgcctacgtcaccgatttcccg
ctcgacctagatattgatccgaaagatgcaaataaagggacacctgaagaaaccggcagc
tatttagtatcaaaggagcttcccaagcattgcctgtacactagactcggttcactgcag
aaactaaaggaacagctgatcttcacagtatgcttgtcatatcagtactcggggctggaa
gataccatagaggagaagcaggaagtgaatgtggggaagcctctcattgctaagctggac
atccatcggggcttgggaaggaacgcttgttttcaaacctgcgtcatgtgcaacggccct
taccagagctctgcgtccccgtccgccggcctttaccgcccttcccaagactccttcctc
ggtgtctaccactcgcatctcggtaactccagcagtgtcccgccgtcagacagttgtcac
tgcagccggactgcagatgccttcatttcaagtcaccgcacacaccagtactcgtctccg
ttcgggagaagtaacgtgccagtcgagacgaccgatgaaataccattcagcttctccgac
gggctcaggatctctgaaaagtga

DBGET integrated database retrieval system