KEGG   Desmodus rotundus (common vampire bat): 112322982Help
Entry
112322982         CDS       T05907                                 

Gene name
ASB13
Definition
(RefSeq) ankyrin repeat and SOCS box protein 13
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
dro  Desmodus rotundus (common vampire bat)
Brite
KEGG Orthology (KO) [BR:dro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dro04121]
    112322982 (ASB13)
Ubiquitin system [BR:dro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     112322982 (ASB13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank Ank_2 Ank_3 Ank_5 SOCS_box
Motif
Other DBs
NCBI-GeneID: 112322982
NCBI-ProteinID: XP_024436453
Position
Unknown
AA seq 278 aa AA seqDB search
MEPRVADACFLGDVGFWVERTPVHEAAHRGEALELQQLIENGACVNQVMVDSITPLHAAS
LQGQAQCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASP
LHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKLLLNAGANVNAAK
LHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEHYEKTPL
TLLQLCRVSFRRATGVRGLEKIAKLNIPSRLINYLSYN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggagccccgggtcgctgacgcctgcttcctgggcgacgtgggtttctgggtggagcgc
actcccgtgcatgaggctgcccatcgcggtgaggccctggaactgcagcagttgattgag
aatggcgcctgtgtcaaccaggtcatggtggattccatcacacccctgcacgcagccagt
ctgcagggccaggcacagtgtgtgcagctgcttctggctgctggggcccaggtggatgcc
cggaacattgatggcagtacccctctctgcgatgcttgtgcctcgggcagcatcgagtgt
gtgaagctcttactctcctatggggccaaggtcaacccacccctgtacacagcctcccca
ctgcatgaggcctgcatgagcggaagttccgaatgcgtgaggcttctaattgatgttggg
gccaatttggaagcacatgattgccattttgggacccccctgcacgttgcttgtgcccgg
gagcatctggactgtgtcaaactgctgctcaatgcaggggctaatgtgaatgcagcaaag
cttcacgagacagcccttcatcatgcagccaaggtgaagaacgtggaccttatcgagatg
ctgattgagtttggaggcaacatctatgcacgggacaaccgggggaagaagccctctgac
tacacgtggagtagcagtgcccctgccaagtgctttgagcactacgaaaagacaccccta
accctgttacagctctgcagggtgagctttaggagggccaccggtgtcagaggcctggag
aaaatcgccaagctgaacatcccttcccggctcatcaattacctttcctacaactga

DBGET integrated database retrieval system