KEGG   Dehalobacter restrictus: DEHRE_00710Help
Entry
DEHRE_00710       CDS       T02996                                 

Definition
(GenBank) carbon monoxide dehydrogenase
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
drs  Dehalobacter restrictus
Pathway
drs01100  Metabolic pathways
drs01120  Microbial metabolism in diverse environments
drs01200  Carbon metabolism
Module
drs_M00377  Reductive acetyl-CoA pathway (Wood-Ljungdahl pathway)
drs_M00618  Acetogen
Brite
Enzymes [BR:drs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase
     DEHRE_00710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AHF08834
Position
complement(137442..138227)
Genome map
AA seq 261 aa AA seqDB search
MDRFLIIGERIHCISPVIRQAIADRNPAPILQRAKEQLDAGAVYLDLNIGPAERDGEEVM
AWAVQLLQNEFDNVPICLDTANKKAIEAGIRVYNRSKGKPIINSADAGPRLGLLEVAAAN
DAMAIALCAKDGIPSDVEERITYCTEMLEKAMMLGIDPMDLLFDPLFLVIKGMQEKAPEV
LETIRQITEMGLRTNAGLSNVSNGAPKHVRPIIDATYCAMAMQCGLTAAIVNPCDHRLME
TIKTCDMIKGNMLYADSYLEL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggatagatttttaataattggtgaaagaatccactgtatttctccagtcattcggcag
gccatcgctgaccgtaatcctgccccgattctccagagagctaaagaacagcttgatgcc
ggtgctgtttacctcgacctgaatattggacctgccgaaagagacggcgaagaagtcatg
gcctgggccgttcagcttctgcagaatgaatttgataatgttccgatttgtttggataca
gccaataaaaaagcaattgaagccggtatcagagtctacaaccgttccaaaggcaaaccg
attatcaattctgccgatgccggtccaagactggggctcttagaagtcgccgccgccaac
gatgccatggctattgccctgtgtgctaaagacggcattccttctgacgttgaagaacgc
atcacctactgcaccgaaatgctggaaaaagcaatgatgctcggtatcgacccgatggat
ctcttatttgacccgctgtttctggtcatcaagggcatgcaggaaaaagcaccggaagtc
cttgagaccattcgccagatcacggaaatgggcctcagaaccaatgctggattaagcaat
gtctccaatggtgctccaaaacatgtccgtccgatcattgacgccacctattgtgcaatg
gccatgcaatgcggtctgactgcagccattgtaaacccttgcgaccacaggcttatggag
acaatcaaaacctgtgacatgattaaaggcaatatgttatatgccgattcctacctggag
ctatga

DBGET integrated database retrieval system