KEGG   Dehalobacter restrictus: DEHRE_02835Help
Entry
DEHRE_02835       CDS       T02996                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
drs  Dehalobacter restrictus
Pathway
drs00220  Arginine biosynthesis
drs01100  Metabolic pathways
drs01110  Biosynthesis of secondary metabolites
drs01130  Biosynthesis of antibiotics
drs01230  Biosynthesis of amino acids
Module
drs_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:drs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    DEHRE_02835
Enzymes [BR:drs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     DEHRE_02835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AHF09160
Position
554262..555206
Genome map
AA seq 314 aa AA seqDB search
MVQLNKGKFKGRDFITLNAFTAEEISYMVDVAMELKADRNAGIPHPVLQGKVLAMIFTKS
STRTRVAFEAGIYQLGGSGMFLSARDIQLGRGEPIQDTARVLSRMVDGIMIRTFSHQEVL
DLAEHSSVPVINGLSDFLHPTQILADLLTIKETKGKIQGLKLTYIGDSNNVANSLLLGGS
KMGMNIVIASPQGYQPVPEIMDLAWKNASLSRSTVQIVEDPVAAARGADILYTDVWASMG
QEEQSEIRKKIFAPYQINDEVLGAAHPEAIVMHCLPAHRGEEITDKVIEGPQSVVFQEAE
NRLHAHKAIMALVM
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggttcaattaaacaaaggcaagtttaaaggcagagattttattacactgaatgctttc
acagcagaagaaatctcatatatggttgacgtcgccatggaattgaaggctgacagaaat
gccggaattccccaccctgtcctgcaggggaaggttttggcgatgatctttaccaaatct
tcgacgagaaccagagtggcatttgaggccggtatttatcagctcggcggctccggaatg
tttctgagcgcccgcgatatccagctgggacgcggtgaaccgatccaggatacagcaagg
gtcttgtccaggatggtcgacggcattatgatcagaacgttcagccatcaggaggttctt
gatcttgccgagcattcctctgtgccggtcatcaatggcttgagcgattttctgcatccg
acacagattctggccgaccttttgaccattaaagaaacaaaaggcaagattcagggattg
aaattaacctatatcggtgacagcaataatgtggcaaattccctgctgcttggcggcagc
aagatgggcatgaacatcgtgattgcttcacctcagggataccagccggttccggaaatt
atggatctggcttggaagaatgcatctctcagcagaagtacggtgcagatcgtcgaagat
cctgtggcggctgccaggggagcggatattctttataccgatgtttgggccagtatggga
caggaagaacaaagcgaaatcaggaagaaaatttttgcgccgtatcagatcaatgacgaa
gtgcttggggcagctcatcctgaagcgatcgtcatgcactgtttgcctgcccaccgcgga
gaagagatcaccgacaaagtgatcgaaggtcctcaatccgtggtatttcaggaggctgaa
aaccggcttcacgcccataaagcgattatggcgctggtcatgtaa

DBGET integrated database retrieval system