KEGG   Dehalobacter restrictus: DEHRE_08175Help
Entry
DEHRE_08175       CDS       T02996                                 

Definition
(GenBank) cobyrinic acid a,c-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
drs  Dehalobacter restrictus
Pathway
drs00860  Porphyrin and chlorophyll metabolism
drs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DEHRE_08175
Enzymes [BR:drs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     DEHRE_08175
    6.3.5.11  cobyrinate a,c-diamide synthase
     DEHRE_08175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA SNO
Motif
Other DBs
NCBI-ProteinID: AHF10057
Position
complement(1624755..1626125)
Genome map
AA seq 456 aa AA seqDB search
MKAVIPRIMFAAAGSSSGKTTITCAVLQALLEQGVNPAAFKCGPDYIDPMFHTEVIGTKS
RNLDLFMLSEEVCRYLLVKNSEQSQIAVLEGVMGYYDGLGIGSTVASSYHLAAVTQTPVI
LIANCAGSAISIAALIQGFCHFRPDNGIKGVILNNLTPSLYPQYKEMIEKETDIQVVGYF
PKLKECALESRHLGLITASEVEDLQQKMKLLAIQARESIDLKQLLRIAGRAAEIDYHEAA
IEKISAVKIAVARDKAFCFYYQDSLDLLETLGAELQYFSPLDDQAVPECDGLILGGGYPE
LYTGQLARNTSMLASIRHVLSNNTPCIAECGGFMYLLERIADKDGKPYPMAGYLEGDAVL
TDKLNRFGYITLTAQKDNLLCDKGGKINAHEFHYSDSTANGSNFTAVNSSGSKTWDCIHA
DENLVAGYPHLHLWGNPEFARSFIRKCGSFRTARMG
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttattccacgtattatgtttgcggctgcaggcagcagcagcggcaagacc
acaattacttgtgcggtattacaagcccttctggagcaaggagttaatcctgctgcgttt
aaatgtgggccggactatattgatccgatgtttcataccgaagtcattgggacaaaatca
cggaatctggatttgtttatgctatcggaagaggtatgccggtatttgctggtcaagaat
tccgaacagtcgcaaatcgctgttttagaaggagtaatgggttattatgacgggctaggc
attggcagtaccgtggcaagttcttaccatttggctgcagtaacgcaaacgcctgttatc
cttattgccaattgtgccggttcagcaatctcaattgcagccttgatccaaggattctgc
cattttagaccggacaacgggatcaagggcgttattctgaataatcttacaccttcccta
tacccgcagtataaggaaatgatcgaaaaagagacggatatccaggtggtcggttacttt
ccgaagctcaaagaatgcgcgctggaaagcaggcatcttggattaattacagcatcggaa
gtggaagacctgcagcaaaaaatgaaattactggccatacaggccagagaatccatcgat
ctgaaacagctgctgcgtattgcaggcagggccgcggaaatagactatcatgaggccgcg
atcgagaaaatctctgctgtcaaaatcgccgtagccagagataaagccttttgtttttat
taccaggacagcctcgaccttttggaaacattgggagcggaactgcagtattttagtccg
cttgatgatcaagctgtaccggaatgtgacggactgattctcggcggcggttatccggaa
ttatataccggacagctggccaggaatacatcgatgctggcaagcatcaggcatgttctc
tccaataatactccctgtatagctgagtgcggcgggttcatgtatttattggaacgtatt
gctgacaaggacggcaaaccttatccaatggcaggatatttagaaggggatgctgtactg
acggataaactgaaccgtttcggttatattacactgacggcgcaaaaggacaacttgctg
tgcgacaaaggcggcaagatcaatgcgcatgaatttcattactctgattcgacggccaac
ggcagcaattttacggcagtaaattcatccggcagcaaaacgtgggactgcatccatgcc
gatgagaacctcgttgccggctatccccaccttcatctctgggggaatccggagtttgcc
cgttcgtttatccggaaatgcggtagctttcgaaccgctaggatgggttag

DBGET integrated database retrieval system