KEGG   Dehalobacter restrictus: DEHRE_11360Help
Entry
DEHRE_11360       CDS       T02996                                 

Definition
(GenBank) segregation protein B
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
drs  Dehalobacter restrictus
Pathway
drs00450  Selenocompound metabolism
drs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DEHRE_11360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:drs03016]
    DEHRE_11360
Enzymes [BR:drs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     DEHRE_11360
Transfer RNA biogenesis [BR:drs03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    DEHRE_11360
 Prokaryotic Type
    DEHRE_11360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AHF10585
Position
complement(2259474..2260481)
Genome map
AA seq 335 aa AA seqDB search
MCHFPKQTSNPDLLIGFDTSDDASVYRLNNNQAIVQTVDFFTPIVDDPYSFGQIAAANAL
SDIYAMGARPLTALNLVSFPIDKLDKSILMEILRGGKDKVEEAGALIIGGHSIDDPEPKY
GLSVTGIIHPDRVLTNSSARENDLLVLTKPLGLGIITTGIKNGIVPATDEKAAIEVMARL
NKETSEIAVQTGVNACTDITGFGLLGHLHEMMKASGMQAEIFAGNVPVLDCAWDCLEKGT
IPGGTLSNLIYLEDYLDAECSLDWKLILGDAQTSGGLLLAVPEEKIETLITECHNRNVHS
VEIIGRISKGEPGKVLIRGGTHAFTKTTINGVGQT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtcactttccaaaacaaacgtccaacccggatcttctgatcggctttgatacgtca
gatgatgcgagtgtctaccgtcttaataacaatcaggcgatcgtccagacagttgacttt
tttactccgatcgttgatgatccatattctttcgggcaaattgccgcagccaacgccctc
agtgatatctatgccatgggtgcgcgtccgctgactgcgctgaatcttgtttcttttccg
attgataagcttgataaaagcatattaatggagatactaagagggggaaaagacaaagtt
gaagaagccggagccttaatcatcggtgggcattcgatcgatgatcctgaaccgaagtat
ggtctgtccgtaacaggcattattcatcctgatcgggtgctgactaattccagcgccagg
gaaaacgatttgctcgttctgacaaaaccattaggacttgggattatcacgactgggata
aaaaacgggattgtcccagcaacggatgagaaagccgccattgaggtcatggcacggctg
aataaggaaacgtcggagattgcagtccagaccggagtaaatgcctgtacggatattacc
ggctttggtctgttgggacatcttcacgaaatgatgaaagccagcggtatgcaggctgag
atatttgcagggaatgttccggttttggactgtgcctgggactgtctagagaaaggaaca
atccccggaggaacattgtccaacctgatttatctcgaggattatctggatgcagagtgc
agtctggactggaaattgatcctcggtgatgctcagacttcaggtgggctgcttctggca
gtgcctgaagaaaaaattgaaacgctaatcacggaatgtcataacaggaatgtgcattct
gtcgaaatcattggcagaatatcgaagggagaacccggaaaagtattaattcgtggggga
acccatgcctttaccaagacaacgataaatggagtgggacagacttga

DBGET integrated database retrieval system