KEGG   Desulfohalobium retbaense: Dret_0252Help
Entry
Dret_0252         CDS       T00989                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00860  Porphyrin and chlorophyll metabolism
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01120  Microbial metabolism in diverse environments
Module
drt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dret_0252
Enzymes [BR:drt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Dret_0252
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dret_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ACV67554
UniProt: C8WZS9
Position
315245..316780
Genome map
AA seq 511 aa AA seqDB search
MACVYLLGAGPGDPGLLTLKAKRILETADVVVYDYLANKAFLNFCRPEAEILYVGKKGGD
HTLPQDKINDLLVEKAKAGKVVARLKGGDPYVFGRGAEEAEELLEAGMDFEVVPGVTSAV
AGPAYAGIPLTHRKYASSVSFITGHEDPDKPESAHNWQALAAGTSTLVFFMGVKNLPHIS
SSLIANGMDPETPAALVRWGTTCEQTSLAAPLHAIAEEAQKQGMRPPALLVVGQVVRLRE
TLGWFEKKPMLGCRVVVTRAREQASSFLSLLEEKGACCLQFPTIAIEALPDYGEVQEAIG
TLAEYDWLIFTSVNGVIWFWKELQRAGLDSRALGGRQVAAIGPATADKLREKGIEPDFVP
EKYVAEHVVEGLLARGVAGKKVLLPRAEVAREVLPRQLREAGTEVRVLPVYRTGLAQQGE
EEAQLLEDLQAGKVQYVTFTSSSTVENFFSRIPAETIAPYVGTSLRLACIGPITANTLQQ
YGFTAQVEPEEYTIPALAQALEEDCLHFRGQ
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcgtgtatctcttgggagccggcccgggcgaccccggcctgttgaccctcaaa
gccaagcgcattttggagacggctgatgtggtcgtctacgattatttggccaacaaagcc
tttctcaatttctgccgccccgaggcggagatcctgtatgtaggcaagaaaggtggggac
cacaccctgccccaggacaaaatcaacgaccttttggtggaaaaggccaaagcggggaag
gtcgtcgcccggcttaagggcggagacccgtacgttttcgggcgcggcgccgaagaagcc
gaagagttgctcgaggccgggatggactttgaagtcgtgccaggggtgacctctgccgtg
gccggtcccgcctatgccggcatcccgttgacgcaccgcaagtacgcctcctctgtttcc
tttatcaccggtcacgaagatccggataaaccagagagcgcgcacaattggcaggccctg
gccgccgggacgagcactctggtctttttcatgggcgtgaaaaatttgccccatatcagt
tcgagtttgatcgccaacgggatggatccggagaccccggccgcgttggtacgctgggga
acgacctgcgaacagacctctttggctgctcctctgcacgctattgccgaggaggctcaa
aagcaggggatgcgcccgccagcgctgctcgtggtggggcaggtggtgcgtttgcgggag
accctgggctggtttgagaagaaacccatgctcggatgccgggtggtggtcacccgggcc
cgggaacaggcgagcagctttttgtccctgctcgaagaaaaaggggcctgctgcctccaa
tttccgacgatcgcgattgaagccctgcccgattacggggaagtccaagaggccataggg
acgctcgctgaatacgattggctcattttcacctcggtcaatggggtgatctggttctgg
aaggagttgcaacgggccggactcgacagccgggccctggggggacggcaggtggccgcc
attggcccggccactgccgacaagctccgggagaaggggatcgaaccggattttgtgcct
gagaagtatgtggcggagcatgtggtcgaaggccttctcgcccgtggtgtcgccggcaag
aaggtgttgctgccccgggctgaagtcgcccgggaggtgctgccccggcagctccgagaa
gccggaaccgaggttcgcgtcctgccggtgtaccgcaccgggctggcccagcaaggcgag
gaagaggcccaattgcttgaggacttgcaggctggaaaggtccaatatgtgacctttacc
agttcttcgacggtggagaattttttcagccgcatcccggccgagaccatcgccccgtat
gttgggacatcgctgcgtctggcctgtatcgggccgattacggcgaacaccctgcagcag
tatggatttacggcgcaggtggagcccgaggagtacaccatcccggccctggcccaggcc
ttggaagaggattgcctccatttcaggggccagtaa

DBGET integrated database retrieval system