KEGG   Desulfohalobium retbaense: Dret_0331Help
Entry
Dret_0331         CDS       T00989                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00620  Pyruvate metabolism
drt00630  Glyoxylate and dicarboxylate metabolism
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01120  Microbial metabolism in diverse environments
drt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:drt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dret_0331
   00630 Glyoxylate and dicarboxylate metabolism
    Dret_0331
Enzymes [BR:drt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dret_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACV67633
UniProt: C8X008
Position
414405..416594
Genome map
AA seq 729 aa AA seqDB search
MTEYVRSGGLQVAAPLAELVAQEVTPGIGVDPEKFWTALAQAVRDFAPRNAALLKERDRL
QEQIDQWFQDRRGQAHDAAAHKKFLYDIGYLIPEGEDFSIRTSDVDPEISAVAGPQLVVP
VNNPRYALNAANSRWGSLYDALYGTDVLPETDGAEKTAEYNPVRGEKVVEHAARFLDQAV
PLAQGSYTGVTGYAVRHDDGVARLEVALDDGSVTGLRDGQQFVGYVGEDRLSAVLFRHNG
LHIEIQIDPEDPIGRNHPAGVKDVVVEAAMTTILDCEDSVTAVDGVDKTVAYRNLLGLFR
GDLETSFSKGGQTVERRLHPDRSYTSPEGRLFHLHGRSLMLVRTVGHLMTSDAVLDEEGR
QIPEGILDTFMTALIGLHDLKKTGPFQNSRSGSLYIVKPKMHGPEEVAFTCELFAAAEES
LGLPSRTLKVGVMDEERRTTLNLKECIRQAQDRIIFINTGFLDRTGDEIHTNMEAGPMVR
KNEMKQEPWMQAYEDWNVDVGLAAGFRGRAQIGKGMWPKPNKMREMLETKQVHPEAGANC
AWVPSPTAATLHALHYHQVEVNARQVALEGQRRASLDDLLTIPVLRSAAPSEAEIQQELE
NNAQSILGYVVRWVEQGIGCSTVPDINDIGLMEDRATLRISSQHIANWLYHGICSKDEVL
AVLKRMAAVVDRQNSGDPFYRPMAEDFDNSVAFQAACDLVFKGCEQPNGYTEPILHARRR
EAKAKFGIE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgacggagtatgtccgtagtggaggactccaggtagcggcgccgttggccgagctggtg
gctcaggaggtgacgcccggaatcggcgtagatccggagaagttctggaccgctctcgcc
caggctgtgcgcgatttcgctccgcgcaatgcggctttgttgaaagagcgggaccggctg
caggagcagatagaccagtggttccaagaccgtcgcggtcaagcgcatgatgctgcggcg
cacaagaagtttttatacgatatcggctatttgattcccgagggcgaggatttttccatt
cggacttctgatgtggatccggagatttcggctgtggcggggccgcaattggtcgtgcct
gtcaataacccccggtatgcgctcaacgccgccaattcccgctggggcagcctctacgac
gccctctacggtacagatgtcctgccggaaaccgacggagcggagaagaccgcagaatac
aacccggtccgcggcgaaaaggtcgtcgaacacgccgcccgttttctggatcaggccgtc
cccctggcccagggctcctacaccggtgtgaccggatatgccgtccgccacgatgacggc
gtagcccgcttagaagtggcccttgacgatggatctgtcaccggattgcgcgacggacag
caatttgtgggctatgtgggggaggaccggttgtcagccgttctctttcgccataacggg
ctgcacattgagatccagatcgatcccgaggaccccatcgggcgcaatcacccggccggg
gtcaaggatgtggtggtcgaggcggccatgaccaccattctcgattgcgaggattcggtg
accgccgtggatggtgtggacaagacagtcgcctaccgcaatttgctgggcctttttcga
ggggacctggagacctcgttttccaagggcgggcaaaccgttgagcggcggctccacccg
gaccgcagctacacctcgcctgagggacgccttttccatctccacggccggagtctgatg
ctcgtacgcactgtcgggcatctcatgacttcggacgccgtgctggacgaagaggggcgg
cagatccccgaaggtatcctcgataccttcatgaccgcgcttatcggattgcatgatctg
aaaaagaccggcccgttccagaacagccgtagcggcagcctgtatatcgtcaaacccaaa
atgcacggtccggaggaagtggccttcacctgcgagctgttcgcggcggcggaagaatcc
ctgggcctgcccagccggaccttgaaagtcggggtcatggacgaagagcggcggaccacg
ctcaacctcaaagaatgcatccgtcaggcccaggaccggattatttttatcaataccggg
tttctggaccgcaccggcgacgagatccatacgaatatggaagccggccctatggtgcgc
aagaacgagatgaagcaggaaccctggatgcaggcctatgaggactggaacgtcgatgtc
ggattggccgccgggttccgcggacgggcccagatcggcaagggcatgtggcccaagccg
aacaagatgcgggagatgctcgagaccaaacaggtccatcccgaggcgggcgccaattgc
gcctgggtgccctcgcccacggcagcgactctgcacgccctgcactaccaccaagtggag
gtgaacgcccggcaggtcgccctcgaagggcagcggcgggcttcgctggatgatttgttg
accattccggtgctgcggtctgcggctccgtcggaggcggagatccagcaggagttggaa
aacaatgcccagagcatcctgggctatgtcgtgcgctgggtggaacagggcatcggctgt
tcgacggtgccggatatcaacgatatcgggttgatggaagatcgggcgactttgcgcatt
tccagtcagcatatcgccaactggctctatcacgggatatgcagcaaggacgaggtcctg
gcggtgctcaaacgcatggcggctgtggtcgatcgccagaacagcggggatccgttctac
cgtcccatggccgaggactttgacaatagcgtggcctttcaggcggcgtgtgatctggta
ttcaaagggtgtgaacagcccaatgggtataccgaacccattttgcacgcccgtcgccgg
gaagcgaaagcgaaattcgggattgagtga

DBGET integrated database retrieval system