KEGG   Desulfohalobium retbaense: Dret_1722Help
Entry
Dret_1722         CDS       T00989                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00040  Pentose and glucuronate interconversions
drt00052  Galactose metabolism
drt00500  Starch and sucrose metabolism
drt00520  Amino sugar and nucleotide sugar metabolism
drt01100  Metabolic pathways
drt01130  Biosynthesis of antibiotics
Module
drt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dret_1722
   00052 Galactose metabolism
    Dret_1722
   00500 Starch and sucrose metabolism
    Dret_1722
   00520 Amino sugar and nucleotide sugar metabolism
    Dret_1722
Enzymes [BR:drt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dret_1722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACV69006
UniProt: C8X3K9
Position
complement(1983589..1984455)
Genome map
AA seq 288 aa AA seqDB search
MQVDKVVVPVAGWGTRSLPATKNLPKEMLPVYKKPAVQYVVEEAMMAGLTDVVFVNNQNK
TIIEDHFDYNLALESVLQRTGKLDMLEQIREVAEMVNITSVRQKSQLGLGHAVLCARKVV
KDSPFAVLVGDDLLFDAEPGIKQLIEVAKAEHMAVVGVVQVPADKVPSYGIIQGEEFAPG
MYRVRDLQEKPSRESAVSRLAVVGRYVLTPEIFDHLEGLQPGHGGEIQLTDALQAMARNN
RLLAVRLRGERFDIGDWVDYLTANIYFGLRDPELRDDLAERLKELLPS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcgacaaagtagttgttccagtagccggatgggggacacgttctcttcctgcg
accaaaaatctgcccaaggaaatgttgccggtgtataaaaaaccggcggtgcagtatgtt
gtcgaagaggccatgatggccgggctgaccgatgtggttttcgtcaacaatcagaataaa
acgatcattgaagaccatttcgactacaatctcgccctggaatcggttctccagcggacc
gggaaactggatatgctggaacagatccgcgaagtggccgaaatggtcaacatcacctcc
gtgcgccagaaatcccaactcggacttgggcacgccgtcctctgcgcccggaaggtggtc
aaagattccccctttgcggtcctggttggcgatgatctgctcttcgacgccgaacccggg
atcaagcaacttattgaggttgccaaggccgagcacatggcggtcgtcggggtcgtccag
gtgcctgcggacaaggtccccagctacgggatcatccagggcgaggaatttgccccgggg
atgtaccgtgtccgggacctgcaggaaaagcccagccgcgagtcggcggtttcccggttg
gctgttgtggggcggtatgtgctgactcctgaaattttcgatcatcttgaaggcctccag
cctggacacggcggggaaatccaactcaccgatgccttgcaggccatggcccggaacaac
cgtctcctggctgtccgcctgcgcggcgaacggtttgatatcggggattgggtcgattat
ctgacggcgaatatctatttcgggctccgggaccctgagttgcgcgacgatcttgctgaa
cgtctaaaggagctgctgccctcgtga

DBGET integrated database retrieval system