KEGG   Desulfohalobium retbaense: Dret_1731Help
Entry
Dret_1731         CDS       T00989                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00220  Arginine biosynthesis
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01130  Biosynthesis of antibiotics
drt01230  Biosynthesis of amino acids
Module
drt_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:drt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Dret_1731
Enzymes [BR:drt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Dret_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ACV69015
UniProt: C8X3L8
Position
complement(1994330..1995244)
Genome map
AA seq 304 aa AA seqDB search
MSRHFLRILDIPQQEMLPLIQRAQQLKAVRAQSHLLAGKTILLVFEKASTRTRLSFEMAV
RELGGSTIFMTPMESQLGRSEPLKDSARVFSRYVHGLVVRTFGQEKLEELVEYGAIPVVN
ALTDSYHPCQVMSDLLTMYERTPALKDQVVAWIGDGNNMAHSWINAAAQVGFHLQMAVPA
GYEPDAGLLEQARAAGARISLSQDPREAVTGADYVNTDVWASMGDEAEAEERARAFAGYL
VDEELLRLANPGVKVMHCLPAHRGEEISEAVMEGPASIVWDQAENRLHMQKAILEWVFST
PERG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgacattttctgcgtatccttgatattccccaacaggagatgcttccgcttatc
cagcgggcccagcagctcaaggctgttcgggcccagagccatctcctggccggaaagacg
atccttctggtctttgaaaaggcctcgacgcgaacccgcctttcgtttgagatggcggta
cgtgaattggggggctcgacaattttcatgaccccgatggaatcccaattggggcgcagc
gagccactcaaggattcggcccgggtcttttcccgctatgtccacgggcttgttgtccgg
accttcgggcaagagaaactcgaggaattggtggagtatggcgcaatcccggttgtcaac
gctctaaccgattcctaccacccctgtcaggtcatgagcgatctgttgactatgtacgaa
cgcaccccggccctgaaagaccaggtcgtggcctggatcggagacgggaacaatatggcc
cactcctggatcaatgcggccgctcaggtcggctttcacctccagatggccgtgcccgcc
gggtatgaaccggatgcgggcctgctcgagcaggcccgggcagcaggggcgcggatctca
ttgtctcaggatccccgggaggctgtgaccggagccgattacgtcaataccgatgtctgg
gcctcaatgggcgatgaagccgaagccgaagagcgggccagggcctttgctggctatctc
gtggacgaggaactgttgcggctggccaaccccggcgttaaagtcatgcattgtctgccg
gcgcaccgcggcgaagagatcagtgaggcggtcatggaagggccggcaagcattgtttgg
gatcaggccgagaaccggttgcacatgcaaaaggcgattctggaatgggttttttccacc
ccagagcgggggtga

DBGET integrated database retrieval system