KEGG   Desulfohalobium retbaense: Dret_2289Help
Entry
Dret_2289         CDS       T00989                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00230  Purine metabolism
drt00250  Alanine, aspartate and glutamate metabolism
drt01100  Metabolic pathways
Module
drt_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:drt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dret_2289
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dret_2289
Enzymes [BR:drt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Dret_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ACV69573
UniProt: C8X576
Position
2601220..2602500
Genome map
AA seq 426 aa AA seqDB search
MSNIVVMGAQWGDEGKGKIVDLLTENADLIVRFQGGNNAGHTLVVGDRKVILHLIPSGVL
HEDKTCCIGNGVVLDPQVLCDEVDGLRGHGVRIGPERLKVSPKTHLILPYHKRLDAAREA
AKTGKEKIGTTGRGIGPAYEDKASRVGIRACDVLDFDLLREKIELALKEKNALFAHCYGT
EPLDPDEVFEEIRPWAERLRDYLADISAEIEAARVTGKNVLFEGAQGTHLDIDHGTYPFV
TSSNTVASNAAAGSGVGFATIDRVLAIVKAYTTRVGSGPFPTEMDNEAGTHLLEKGAEYG
STTGRKRRCGWLDIPLLRESVRLNSPAEIALTKLDVLSGLEEIKICVGYRFEGQEWPHPP
QRENALAHVEPIYQTLPGWNLDVSQVTSWGDLPHAAQQYITAIEDLLSVRVGMVSVGPDR
NQTLFL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattgtggtcatgggcgcccaatggggcgatgaggggaaaggaaagattgtt
gacctgctgacggagaatgccgatctcattgtccgtttccaggggggaaacaatgccggc
cacacccttgtcgtgggcgaccggaaagttattctgcacctcattccttccggggttctg
catgaagacaagacctgttgcatcggcaacggggttgttctcgatccccaggtcctgtgc
gatgaggtggacggcctgcgtggtcacggtgtgcggattggccccgaacggctcaaggtc
agccccaagacccacctcatccttccctatcacaaacggctggacgcggcccgagaagcg
gccaagaccggcaaggaaaaaatcggcacgacaggacggggcattggaccggcctatgag
gacaaggcctcccgagtcggcatccgggcctgcgatgtcctggatttcgatctcctgcga
gagaagatcgaactggccctgaaagagaagaacgccttgttcgctcactgctacggcacg
gagccccttgatccggacgaggtttttgaggagatccgcccctgggccgaacgtcttcgg
gactacctggctgacatttcggccgaaatcgaggcggcccgcgtcaccggcaagaacgtc
ctcttcgagggcgcccagggcacccatctggatatcgatcacggcacctatccctttgtg
acttcctccaacactgtcgcctccaatgccgcggcaggcagcggtgttggcttcgccacc
atcgaccgggtcctggccatcgtcaaggcctacaccactcgggtaggctccggcccattc
ccgacagagatggacaatgaagccggcacccacctcctggaaaaaggagctgaatacggc
tccactacaggacgtaaacgccgttgcggctggctggacatcccgcttttgcgcgagtcg
gtccgcctgaacagccccgcggaaatcgccctgaccaaacttgatgtcctcagcgggctg
gaagagatcaagatctgtgtcgggtaccgctttgagggccaggaatggccgcacccgccg
caacgggaaaacgctctcgcccacgtcgaaccgatctatcagaccctcccaggctggaat
ctggacgtgagtcaggtgacctcctggggcgatcttccccatgccgctcagcaatacatc
acggccatcgaagacctcctgagcgtgcgcgtcggtatggtttccgttggaccggatcgc
aaccagaccctttttctctag

DBGET integrated database retrieval system