KEGG   Desulfohalobium retbaense: Dret_2292Help
Entry
Dret_2292         CDS       T00989                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00730  Thiamine metabolism
drt00790  Folate biosynthesis
drt01100  Metabolic pathways
drt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:drt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Dret_2292
   00790 Folate biosynthesis
    Dret_2292
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dret_2292
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:drt04147]
    Dret_2292
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:drt00537]
    Dret_2292
Enzymes [BR:drt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dret_2292
Exosome [BR:drt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dret_2292
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:drt00537]
 Enzymes
  Dret_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: ACV69576
UniProt: C8X579
Position
complement(2604653..2606116)
Genome map
AA seq 487 aa AA seqDB search
MRMLKKQFLLRLALFLVVVSLLPSLALAKQAKYVFLFIGDGMGLPQRSAAAEFIQGELLM
DSFPAQGITSTYAADRFITGSAPAATAMASGQKTNIGVVGLDTQLRPVKTLAEMAKEQGK
KVGIVSSVSIDHATPAAFYAHVKARGQYYDIDVALAESGFDYFAGGGLKDPDNSRDNSAN
YVGNALDLAKENGYTLINSKPAFAKLGPADGKVLAWNDWLQNSKALPYEMDQRQDQDISL
KEFTAKGIELLDNEKGFFMMVEGGKIDWACHANDATAAIHDTLAFDAALNEAYTFYEQHP
EETLIVVTGDHECGGLTLGFAGTKYATNFEVLGKQKISFRKFTQQVLPAFKENGEASFAD
IKPVIEDNFGLRFDGPAEDPMTLAAHEVAQIKEAFGRSMGAEKVSSEDKRTYLLYGGYDP
LAVTLTHILDQKAGMGWTSYKHTGVPVSTSAIGVGAKQFNGSYDNTDIATKIMESMGIAP
KVYLATN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgctcaaaaagcaatttctgctgcgtctggcactgtttcttgtggttgtgtcc
ctgctgccgagtctggcactggccaagcaggccaagtacgtctttttgtttatcggggac
ggcatgggattgccgcagcgcagtgcagccgctgaatttatccaaggggaattgttgatg
gacagtttcccggcccagggtatcacctcgacctatgccgcggaccgctttatcaccggt
tcggctccggcggccacggccatggccagcggccagaagacgaacatcggcgtggtcggt
ctggacacccagctgcgcccggtgaaaacattggcggaaatggccaaggagcagggcaag
aaggtcgggattgtctcctcggtgtccatcgaccacgccacgcctgcggccttttatgcc
cacgtcaaagctcgcggccaatactatgatattgatgtggccctggcggaaagcggcttc
gactacttcgccggtggggggttaaaggatccggacaactcccgcgacaattccgcaaat
tacgtcggcaacgccctcgatctggccaaggaaaacgggtacaccctgatcaattccaag
ccggccttcgcaaaattgggcccggctgacggcaaagttttggcctggaatgactggctg
caaaacagcaaggccctgccctacgagatggaccagcgccaggatcaggacatctcgctc
aaggaattcacggccaagggcatcgagttgttggacaacgagaagggctttttcatgatg
gtcgaaggcggcaagatcgactgggcctgccacgccaacgacgccaccgctgccattcac
gacaccctggcctttgatgccgcgttgaacgaggcttacacattctatgaacagcatccg
gaggaaaccctgatcgtggtcaccggtgaccacgaatgcggcggtttgaccctcggtttt
gccggtacaaagtacgccaccaatttcgaggtcctgggcaagcagaagatctcctttcgc
aaatttacgcagcaggttctgccggccttcaaggaaaacggggaagcgagctttgcggac
atcaagccggtgatcgaagacaatttcggcctgcgctttgatggtccggccgaagacccc
atgaccctggccgcccatgaggttgctcagatcaaggaggccttcgggcgctccatgggc
gcggagaaggtcagctccgaggacaagcggacctacctcctctatggtggctacgatccc
ctggccgtgaccctgacccacatcctggaccaaaaagccggcatgggctggacttcttac
aagcacaccggtgtgccggtctctacctcggccatcggagtcggtgccaaacagttcaac
gggtcgtatgataataccgatatcgccacgaagatcatggaaagcatgggcatcgcgccc
aaggtctatctggcgaccaactaa

DBGET integrated database retrieval system