KEGG   Desulfohalobium retbaense: Dret_2481Help
Entry
Dret_2481         CDS       T00989                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00010  Glycolysis / Gluconeogenesis
drt00620  Pyruvate metabolism
drt00640  Propanoate metabolism
drt00680  Methane metabolism
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01120  Microbial metabolism in diverse environments
drt01130  Biosynthesis of antibiotics
drt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dret_2481
   00620 Pyruvate metabolism
    Dret_2481
   00640 Propanoate metabolism
    Dret_2481
  Energy metabolism
   00680 Methane metabolism
    Dret_2481
Enzymes [BR:drt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dret_2481
Lipid biosynthesis proteins [BR:drt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dret_2481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N TFX_C
Motif
Other DBs
NCBI-ProteinID: ACV69763
UniProt: C8X5R6
Position
complement(2845926..2847788)
Genome map
AA seq 620 aa AA seqDB search
MSEQHAPEEHLFRPAAPVRMGANLSAQEIEQARAWFADNPEGFWEQAAKELQWNEPWHTV
CDDGDPPTWFAGAKCNIVHNCLDRHVHSANRNKLALVWESEAGETRKWTYFELSREVNRL
AAGLRRLGFQAGSVFVLCLPPLPETVALSLAIAKIGAVQSHVFVGYAAKVLRARIAALQA
ECVVCADGFARNGSVVGLKEIVDTALDSPEGDSVELTIVVPRLGIKQSLRTDRDLAYDDV
LHPVHGNEPTTALDSDHILFVQYTSGTTGTPKGVVHTHGGYMVALNRTMNWVLDIKATDI
LWCQADLGWITGQSYALWGPLLAGSTTMLYEGHPLYPKADRIWRIVEKAGVSILYTTPTL
MRMVKRYGPGFPAQHDLSALRLLAAVGEPLAPEVWLWWHEHIGQGQCPLLNTWWQTETGA
IVISPLPANTLKPGSVGRPLPGIQAAVVDPEGTPVPANTTGHLVLYGSWPGFFNGLFREH
DQSFAGYWSPSQKTYWTGDLARQDADGHLWILGRQDEVLNIAGHILGATEIENGLLVHPG
VHEVAVVPVPDKIRGQAAKAYVVLKEPHQAGDALKTALTELVRQELGPVVRIKDIVFVET
LPKTGSGKILRRALRDSPPA
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacagcacgccccggaagaacatctttttcgccccgcggctcccgtgcgcatg
ggagcgaatctctcggcccaggagatcgagcaggccagggcctggttcgccgacaacccg
gaggggttctgggaacaggcggccaaggaattgcaatggaacgagccgtggcacacggtg
tgcgacgacggggacccgccgacctggtttgccggtgccaagtgcaatatcgtccacaat
tgtctcgaccgccacgtccactccgccaaccgcaataaattggcccttgtgtgggaaagt
gaagccggggaaacccggaaatggacctattttgaattgtcccgagaggtgaaccgcctc
gcagcgggcttgcgccggctggggttccaagcaggatcggttttcgtcctttgcctcccc
ccgttgccggaaaccgtggccctgagtctggccatcgcgaaaatcggggccgtacagagt
catgtctttgtcgggtatgcggccaaggtcttgcgggccaggatcgccgccctgcaggcc
gaatgcgtcgtctgtgccgacggtttcgcccgcaatggaagtgttgtgggcctcaaagag
atcgtggacaccgccttggacagcccggaaggcgacagcgtcgaactgaccatcgtcgtc
ccgcgcctgggcatcaaacaaagcctgcgcactgaccgcgacctcgcctacgatgatgtc
ctccatccggtccacgggaacgagcccaccaccgctctggacagcgaccacatcctcttc
gtccagtacacctccgggacgaccgggacgcccaaaggggtggtccatacccacggcgga
tacatggtcgccttgaatcggaccatgaactgggttctggatatcaaggccacggacatc
ctctggtgtcaggcggatctgggctggatcaccgggcagagctacgccctgtggggaccg
ttattggcgggctcgaccacaatgctctacgagggacaccctctgtaccccaaagccgac
aggatctggcggattgtcgaaaaggccggtgtaagtatcctctacaccacgccgacgctg
atgcgcatggtcaaacgctacgggccgggcttccccgcccagcatgatctgagcgcactc
cgcctcttggccgcggtgggcgaacccctggcgccggaggtctggctctggtggcatgaa
cacatcggtcaggggcaatgccccctgctcaacacctggtggcagaccgaaaccggcgcc
atcgtcatttcccccttgcccgccaataccctcaaacccggctctgtaggacgccccctg
ccgggcatccaggcggccgtagtcgatcccgaagggacccctgtgccggccaacaccacg
gggcatctcgtgctctacgggtcgtggcccggcttcttcaacggcttattccgcgaacac
gaccagagctttgccggctattggagtccctcgcaaaaaacctattggacaggtgatctg
gcgcggcaggatgcggacggccatctctggatactcggccgccaagacgaggtcctgaat
atcgccggacacattctgggagccactgaaattgaaaacggtctgctcgtccatccgggc
gtccacgaagtcgccgtggtccctgtacctgataagatccgcggtcaggcggccaaggcc
tatgtggtcctcaaggagccccatcaggcaggagacgccttgaaaacggccttgaccgaa
ctggtgcgccaggaactcggtcccgtggtccgaatcaaggacatcgtctttgtcgagacg
cttcccaaaaccgggtccgggaaaatcctgcgccgtgccctgcgtgacagcccaccagcc
tga

DBGET integrated database retrieval system