KEGG   Desulfotomaculum ruminis: Desru_0014Help
Entry
Desru_0014        CDS       T01518                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00260  Glycine, serine and threonine metabolism
dru00750  Vitamin B6 metabolism
dru01100  Metabolic pathways
dru01110  Biosynthesis of secondary metabolites
dru01120  Microbial metabolism in diverse environments
dru01230  Biosynthesis of amino acids
Module
dru_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desru_0014
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Desru_0014
Enzymes [BR:dru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Desru_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF NifU_N DUF530 PSRP-3_Ycf65
Motif
Other DBs
NCBI-ProteinID: AEG58320
UniProt: F6DL11
Position
18614..19822
Genome map
AA seq 402 aa AA seqDB search
MSYVTHLECSKCNKQYNSEEVHQLCECGAPLIVKYDLARIKENFRKEDLKDREPSLWRYW
ELLPLKDKKNLVSLGEGMTPIIKMEVAGPEIGLNNLYLKDEGIIPSGTFKSRGATVGVSR
AKELGIKTLAMPTNGNAGASWSTYGARAGIKSVIVMPQDAPEITRNECAITGADLYLVDG
LISDAGKIVARAVQKYGWFDVSTLKEPYRIEGKKTMGLEIAEQFNWEVPDVILYPTGGGV
GIIGIYKALRELQTIGWIGEKMPRLVAVQAEGCAPIVKAWEEKKTESEFWNNASTCAFGI
TVPKALGDFLVLDAIYKTNGCAVAIADNDLLEAQAVLAAKEGTFVCPEGASLYSAARKLR
EQGWIKENEKVVLLNTGTGLKYPETVNVKVPLLQPNDNIPEA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagttatgtaacccatctagaatgctcaaaatgtaataaacagtacaacagtgaagaa
gttcatcaactgtgtgagtgtggtgctcctttgattgttaaatacgacttggctcgtatt
aaagagaactttcgcaaggaagatttaaaagatcgcgaacctagtttgtggcgttactgg
gagttgctgcccttgaaggataaaaagaatctggtttctcttggtgaaggcatgacccct
ataattaagatggaagtggcaggtcctgaaatcgggttaaataatctttatctgaaggac
gaagggattattccttcgggtacttttaaatcccgtggcgctactgtgggtgtttccaga
gcaaaggaacttggtatcaagaccttggctatgcccaccaacggtaatgccggtgcttct
tggtccacctatggtgcaagagcgggtattaaatcagttatagtaatgccccaggatgcg
ccggaaatcacccgtaacgaatgtgcaattaccggtgcggacctttatctagtggatgga
ttaattagtgatgctggtaaaattgttgctagagcagtacaaaaatatggatggttcgac
gtttctaccctgaaagagccttatcgtattgaaggtaaaaagacaatgggtcttgaaatt
gccgagcagtttaactgggaagttcccgatgttattctctatcccactggtggtggcgta
ggtatcattggtatttacaaagcgctgagagaattacagacaataggttggattggtgag
aaaatgccgcgtctggtggctgtacaagccgaaggttgcgctcccattgttaaagcttgg
gaagaaaagaaaacggaatccgaattctggaacaacgcatccacctgtgcttttggtatc
actgttccaaaagccctgggtgacttccttgtgctggatgcaatttacaagactaatggc
tgcgcggttgctattgcagataatgatttattggaagctcaggctgtgttggctgccaaa
gaaggtacctttgtttgtcccgaaggcgcatctctgtatagtgcagctagaaaactgaga
gaacaaggctggattaaagaaaacgaaaaagtggtgctattgaataccggaaccggtctg
aaatatcctgaaactgtaaatgtaaaagtacctcttcttcagcccaatgataatatccct
gaggcttaa

DBGET integrated database retrieval system