KEGG   Desulfotomaculum ruminis: Desru_0239Help
Entry
Desru_0239        CDS       T01518                                 

Definition
(GenBank) pantoate/beta-alanine ligase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00410  beta-Alanine metabolism
dru00770  Pantothenate and CoA biosynthesis
dru01100  Metabolic pathways
dru01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Desru_0239
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Desru_0239
Enzymes [BR:dru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     Desru_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: AEG58537
UniProt: F6DNJ7
Position
234411..235256
Genome map
AA seq 281 aa AA seqDB search
MRLCKTIEEIRSLINAVRAEGKTVGLVPTMGYLHQGHLSLVQEARRRCEVLVVSIFVNPT
QFGPHEDYQTYPRDLQRDAGLLAGAGVDAVFAPEAAEMYPAGFSSYVDVSGVSQCLCGAS
RPGHFRGVATVVSKLFNIVRPDMAFFGQKDFQQVLVIKRMVEDLNMSVQIIDVPIVREED
GLALSSRNVYLSPEERSAALVLHRSLNLALDLVRSGERDTNRLKERIIKEITSEPLADID
YVEIRSLPHLSGLAELSGRALLALAVRFGKTRLIDNVVLEA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagactgtgcaaaaccattgaagaaatccgttcactgatcaatgccgtacgggcggag
ggaaaaaccgtgggcttggtgcccaccatgggctacctgcaccagggacatctgtccctg
gtgcaggaggccagacgccgctgcgaggttctggtggtcagtatttttgttaatcctact
caatttggaccccatgaggattaccaaacctatccccgggacctgcaaagggatgccggc
ctgctggccggtgccggggttgatgctgtttttgccccggaggcggcggagatgtatccc
gccggattcagcagctacgtggatgtcagcggcgtcagccaatgcctttgcggggcctca
aggccggggcatttccgaggtgtggccacggtggtaagcaaattatttaacatcgtacgt
ccggatatggctttttttggacaaaaggatttccagcaggtgctggttataaaacgaatg
gttgaagatttaaatatgagtgtccagatcattgatgtgcccattgttcgggaagaagac
ggtttggctctcagttcccgcaatgtttatctctcgccggaagaacgatccgccgccctg
gtactgcaccgcagtttaaatctggctctggatttggtacgctccggggagcgggatacc
aaccgcttaaaggagcggattatcaaagaaattacctcggaacccctggcggacattgat
tatgtggagatccgctccctgccccatttaagcggcttagcggaactttccggccgggct
ctgctggctctggccgtccgctttggcaagacccggctcattgacaatgttgttctggag
gcatag

DBGET integrated database retrieval system