KEGG   Desulfotomaculum ruminis: Desru_0303Help
Entry
Desru_0303        CDS       T01518                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dru  Desulfotomaculum ruminis
Pathway
dru03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dru00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Desru_0303
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dru03011]
    Desru_0303
Ribosome [BR:dru03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Desru_0303
  Bacteria
    Desru_0303
  Archaea
    Desru_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEG58600
UniProt: F6DPC7
Position
307041..307382
Genome map
AA seq 113 aa AA seqDB search
MEARAIAKFIRVSPRKARMVVDLIRGKKLEEALAILRYTPNKATDAVTKVVKSAAANAEH
NYEMDRDEIFISAIYVDQGPSLKRVMPRAMGRADIIKRKTSHITVVVSDKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgagagcaatcgccaaatttatccgcgtatccccgcgtaaagcccgcatggta
gtcgatttgattcggggcaagaaactggaggaagccttagccattttgcgctacactccc
aataaagctaccgatgccgtgaccaaagtggtcaaatctgctgctgctaacgcggaacac
aattatgaaatggatcgggatgaaatttttatatctgccatttatgtcgatcaaggccca
agtctcaagcgtgttatgcccagggccatgggtcgcgcggatataattaaaagaaaaacc
agccacattaccgtagtggtctcggataaaaaggagggataa

DBGET integrated database retrieval system