KEGG   Desulfotomaculum ruminis: Desru_0619Help
Entry
Desru_0619        CDS       T01518                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00010  Glycolysis / Gluconeogenesis
dru00071  Fatty acid degradation
dru00350  Tyrosine metabolism
dru00620  Pyruvate metabolism
dru00625  Chloroalkane and chloroalkene degradation
dru00626  Naphthalene degradation
dru00650  Butanoate metabolism
dru01100  Metabolic pathways
dru01110  Biosynthesis of secondary metabolites
dru01120  Microbial metabolism in diverse environments
dru01130  Biosynthesis of antibiotics
dru01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desru_0619
   00620 Pyruvate metabolism
    Desru_0619
   00650 Butanoate metabolism
    Desru_0619
  Lipid metabolism
   00071 Fatty acid degradation
    Desru_0619
  Amino acid metabolism
   00350 Tyrosine metabolism
    Desru_0619
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Desru_0619
   00626 Naphthalene degradation
    Desru_0619
Enzymes [BR:dru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Desru_0619
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Desru_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AEG58904
UniProt: F6DST5
Position
647335..649920
Genome map
AA seq 861 aa AA seqDB search
MEKDEQQISAMIDRLVENAKLAQEEFLKLSQEQVDHIVKMMAMAGLDKHMELAKLAVEET
QKGVYEDKITKNIFATEEVYHSIKYEKTVGVVNENPEEDFMEVAEPIGPVAAVIPVTNPT
STTMFKALICIKTRNPVIFSFHPGAQRCSSEAAKIMLQAAIEAGAPQHCIGWIEQPSIQA
TQKLMAHPGVALILATGGAKLVCSAYSSGKPALGVGPGNVPCYIEKTAHIRRAVTDLIMS
KTFDNGLICASEQAVIIDREIADDTIQRMKENGCYFLNPAEVEQLTKLATHGDCCHIRPE
IVGKSAVTIAEMAGLAVPPDTKILVAPLEGVGPDYPLSQEKLSPILALYVVENSDEGIRR
CEEMVEFAGLGHSAVIHSENQQVIEQFSRRIRTGRIIVNSPSTHGAIGDLYNTNVPSLTL
GCGSMGRNSTTSNVSVHNLINIKRVAMRKEKLQWFRVPERIYFMPGSVQYLSKMPGVERV
LIVTDKVMADLGYVDKVIYHLRKRQNDVHIEVFDGVEPDPPMEVVAQGVERMKRFLPDTL
IALGGGSAIDCAKGMWLFFEYPDVEFEHLRLKFLDIRKRTYKYPKLGRRVQLVAIPTTSG
SGSEVTAFTVISDKGKQIKYPLADYELTPDVAIIDSDFVMSIPPKVTADTGLDVLSHAIE
AYVSVMASDYTDGLALKAIELVFRYLPRAYKNGRDKEARFKMHNASAIAGIAFTNAFLGI
NHSLAHKLGGQFGIPHGRANALLLPHVIEYNATLPSKFVSFPNYTFYVAPEKYRQIAKHL
GLPCSTEQEGVRSLISAIQDLMKELEVPQSIAECGVERSQFEGVVHELSEKAFEDQCTTS
NPRMPLISELEEIYRKAYVRG
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaagatgaacaacaaatttcagcaatgattgacaggctggtggaaaatgcgaaa
ttggcccaggaggagttcctgaaattaagccaggaacaagtggatcatattgtaaaaatg
atggctatggcagggctggataaacacatggaactggccaagctggcggtggaggagacc
caaaagggagtctacgaggataaaatcaccaaaaatatttttgccactgaggaagtatac
catagtatcaaatacgaaaagaccgtaggggttgttaacgaaaatcccgaggaagatttt
atggaggtagcggagcccattggcccggtagctgcggttatccccgtaaccaatcccacc
tccaccaccatgtttaaagcattaatttgtatcaagacacggaatccggttattttcagt
tttcaccccggagcccagcgctgcagctccgaggcagccaaaatcatgctgcaggcagcc
attgaggccggagcgccgcagcactgcatcggctggattgaacaaccgtccatccaggcc
acccagaaactaatggcccatccgggagtggctttgattctggccaccggcggggcaaag
ctggtatgctcagcctatagttccggaaaacctgccttgggtgtaggacccggcaatgtt
ccctgctatattgagaaaaccgcccacatccgccgggcggtaacggatttaatcatgagt
aaaacctttgataacggccttatttgtgcctcggaacaagcggtcatcatagaccgtgaa
attgccgatgacaccatacagcgaatgaaagaaaacggttgttattttttaaaccctgct
gaggtggagcagttaaccaaactggccacccatggggattgctgccatatccgtcctgaa
attgtgggtaagtccgctgtcaccattgctgaaatggccggtctggcggtacctccggat
accaaaattctggtggcgcccttggaaggagtaggacccgattatcctctgtcccaggag
aaactgtctccgatcctggccttgtatgttgtggagaacagtgatgagggaattcggcgc
tgtgaagagatggtggagtttgccggactgggacactcggccgtcattcattccgagaac
cagcaggtaattgaacagttctccaggagaattaggaccggccggattatcgtcaactct
cccagcacccacggagccatcggagacctttataataccaatgttccttctttaaccctg
ggttgcggctccatgggacggaactccaccacctccaatgtcagcgtgcacaatttaatt
aacattaaacgggtggccatgcgtaaggaaaaattacagtggttcagagtgcccgagcgc
atttattttatgcctggttcggttcagtatctaagcaaaatgcccggtgtggagcgggtc
ctgattgtgacggataaagtgatggccgatctgggttacgtggataaagtcatttatcat
ctgagaaagcgtcaaaatgacgttcatattgaggtctttgacggcgtggaaccggatccg
cccatggaggtggtagcccagggggtggaaaggatgaagcgattccttccggatacgctg
attgccctggggggaggctccgccattgactgcgccaagggcatgtggctgtttttcgaa
tatcctgatgtggaatttgagcatctgaggttaaaattcttggatattcgcaagcgcacc
tataaataccccaagctgggccgccgggtccaactggtggccattcccaccaccagcggc
agcggttcggaggtcacggcctttacggtcatttccgataaaggcaaacaaattaaatac
cccctagccgactatgagctcacaccggatgtggccattattgacagtgattttgtcatg
tccattccccccaaggttacggcggataccggtctggatgttctaagccatgctattgaa
gcctatgtttcggtgatggcttccgattataccgatggactggccttaaaagccattgaa
ctggtattccggtatcttcccagggcttacaagaacggccgggacaaggaagcccggttt
aaaatgcacaatgcctcggccattgccgggattgcttttaccaatgcctttttagggatc
aaccatagtctggctcataagctgggcggacagttcggcattcctcatggccgggccaat
gcactgttgctgccccatgtcattgagtataacgccaccttgccaagcaagtttgtctct
tttcccaactataccttttatgtggcgccggaaaagtaccgccagattgccaaacatctg
gggttgccctgcagtaccgagcaagagggtgtccgcagtctgatttcagccatccaggac
ttaatgaaagaactggaagttcctcaaagcattgcagaatgcggagttgagaggagccaa
tttgaaggagtggttcatgaattgtccgagaaggcctttgaagatcagtgcaccacctcc
aatccccgcatgcctttgatttcggaactggaagaaatttatcgcaaggcctatgttcga
gggtaa

DBGET integrated database retrieval system