KEGG   Desulfotomaculum ruminis: Desru_0927Help
Entry
Desru_0927        CDS       T01518                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00630  Glyoxylate and dicarboxylate metabolism
dru00660  C5-Branched dibasic acid metabolism
dru01100  Metabolic pathways
dru01120  Microbial metabolism in diverse environments
dru01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Desru_0927
   00660 C5-Branched dibasic acid metabolism
    Desru_0927
Enzymes [BR:dru01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     Desru_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C Enolase_C MR_MLE_N PliI
Motif
Other DBs
NCBI-ProteinID: AEG59203
UniProt: F6DJY9
Position
958745..959992
Genome map
AA seq 415 aa AA seqDB search
MKIIGAVVSPGLTGFYFDDQKAIKLGRERDGFALLGEPATAGFSAVRQRGESISVMLLLD
NGAVAYGDCAAVQYSGAGGRDPLFLAADFIPVLEEEVFPRLIGRTVSGFRRLAEEFDKLR
HADGSFFHTALRYGITQALLDAAARSAGCTMAEIVAREYHCPLVNRPVPLFCQTGDDRYS
NADKAIIKGADVLPHGLINNVREKLGCRGEKLLEYVSWLKNRAGQLGGADYRPVLHIDVY
GTIGQAFDEDLEQMADYLGRLEKAAAPLKLRIEGPMDRGNKPAQIEALAGLCRLLEKRGI
AVAVVADEWCNTLEDIREFVDAKAGDMVQIKTPDLGGINNTIEAVLYARSRGTGAYLGGT
CNETDRSARVCVHVGIATQPDQMLAKPGMGVDEGLMITFNEMSRTLALLKVKGVI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattataggtgcggttgtttcgccgggattaaccggcttttactttgatgatcag
aaggccattaaactgggccgggagcgggacggttttgcacttttgggtgaaccggccacg
gccggtttctccgctgtaaggcagagaggagagtccatctcggttatgctgttgttggat
aacggtgcggtagcctacggggactgtgccgccgtgcagtattccggggccgggggacgg
gacccgctgtttctggcggcagattttatcccggttttggaagaagaggtttttcccaga
ttaattgggcgtacggtcagcggttttcgacggttggcggaggagtttgacaagctgcgc
catgccgacggcagcttttttcatacggccttgcgctacggcattacccaggcgctgctg
gatgcggcggcccggtctgcgggctgcaccatggcggaaatcgtggccagggagtatcac
tgcccgctggtaaaccggccggttcctctcttctgtcagaccggggatgaccgctactcc
aatgcggataaggccattataaaaggggcggatgtgctgccccacggtttaattaacaat
gtaagggaaaaattggggtgccgcggggagaaactgttggagtatgtaagctggctgaag
aaccgggccgggcagttgggaggagcggattaccggccggttttgcatattgatgtgtac
ggcaccatcggccaggcctttgatgaagacctggaacaaatggcagactatctgggtcgt
ctggagaaggcggccgctcccctgaagcttcgcattgaggggcccatggaccggggcaac
aaacctgcccagattgaggctctggccggactgtgccggctgctggaaaagagagggatt
gcggtggctgtggtggcggatgaatggtgcaacaccctggaggatattcgggagtttgta
gacgcgaaggcaggggatatggtacagattaaaaccccggacctggggggcatcaacaac
accattgaagcggttttatacgccagatcaaggggtaccggcgcttacttgggcggcacc
tgtaatgaaaccgaccgctcggcccgggtctgcgtgcatgtgggtattgccacccagccc
gaccaaatgctggccaaacccggcatgggtgtggacgagggcctcatgatcaccttcaat
gaaatgagccgcaccctggctctattgaaagtcaagggggttatttaa

DBGET integrated database retrieval system