KEGG   Desulfotomaculum ruminis: Desru_1705Help
Entry
Desru_1705        CDS       T01518                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00430  Taurine and hypotaurine metabolism
dru00620  Pyruvate metabolism
dru00640  Propanoate metabolism
dru00680  Methane metabolism
dru00720  Carbon fixation pathways in prokaryotes
dru01100  Metabolic pathways
dru01120  Microbial metabolism in diverse environments
dru01200  Carbon metabolism
Module
dru_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:dru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desru_1705
   00640 Propanoate metabolism
    Desru_1705
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desru_1705
   00680 Methane metabolism
    Desru_1705
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Desru_1705
Enzymes [BR:dru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Desru_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: AEG59969
UniProt: F6DSX5
Position
1731855..1733042
Genome map
AA seq 395 aa AA seqDB search
MLILVVNSGSSSIKYKLMDMERETVLLSGLAERIGLHGSKVKQTSDTGELVLEQDLPDHK
VAMEIVLRCITDPQYGAINDVSSIKAVGHRIVHGGENFKKSMVVTDELIQGLEEIADLAP
LHTIPHIVTIKSCRELISHAPQVTVFDTAFHQTIPKYAHMYGVPYELYQKYKIRRYGFHG
TSHKYVSGRAAEILGKPLNELKIVVCHLGNGSSITAVGNGASIDTSMGFTPLAGLPMGSR
TGDMDPAVVPFIMEKENLNVNEINDLMNKKSGVLGVSGVSSDFRDLEEAAEKGHERAELA
LSMFAYSIIKYVGAYTAALGGLDLLVFTGGIGENSKDMRARVLKGLAYTGLEVDEENNNT
RGKEIIISKPGSKITAMVVPTNEELMIARETKALV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgctcattctggtcgtaaactctggcagttcttcaattaaatacaaattaatggatatg
gagagggaaacggttcttttatccggcctggcggaacgaatcggcttacatggctccaaa
gtcaagcaaacttcggacaccggagaactggtgctggaacaggatctgcctgatcataag
gtagccatggaaattgttctaaggtgtattactgatccccaatacggagccatcaacgat
gtttccagcatcaaggccgttggtcaccggattgtccacggtggagaaaatttcaagaaa
tccatggtggttaccgatgaattgattcagggactggaggaaattgccgacctggctcct
ttacacaccatccctcacattgtaaccattaagagctgccgggaactgatctcccatgct
ccccaggtaactgtatttgatactgcctttcaccagaccatacccaaatacgcccatatg
tatggcgttccctatgagctttaccagaaatacaagatccgcaggtatggatttcacggc
acttcccacaaatatgtttccggtcgggcggcagaaattttaggaaagcccctaaatgag
ttaaaaattgtggtctgccatttaggcaacggttccagtattacggcggtggggaacggt
gcttctatcgatacttccatgggctttacaccgctggcgggacttcccatgggctcccgt
accggcgatatggatccggctgtggttccctttattatggaaaaggaaaacctcaatgtt
aacgaaatcaatgatctgatgaacaagaaaagcggggtactgggtgtatcgggcgtcagc
agtgattttcgggatctggaagaggcggctgaaaagggtcacgagcgggcggagttggct
ttgagcatgtttgcttacagcatcattaaatatgttggcgcctatacggcggcactgggc
ggtctagacctgctggttttcaccggcggcatcggtgaaaattcaaaagatatgcgggcc
agagttttaaagggcttggcttataccggtctggaagtggacgaggaaaacaacaatacc
cgtggcaaagaaatcattatcagcaagcccgggtccaaaattacggccatggtggtgcct
accaacgaagagttaatgattgccagggaaacaaaggctttagtttaa

DBGET integrated database retrieval system