KEGG   Desulfotomaculum ruminis: Desru_2256Help
Entry
Desru_2256        CDS       T01518                                 

Definition
(GenBank) Phosphate butyryltransferase
  KO
K00634  phosphate butyryltransferase [EC:2.3.1.19]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00650  Butanoate metabolism
dru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Desru_2256
Enzymes [BR:dru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.19  phosphate butyryltransferase
     Desru_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB
Motif
Other DBs
NCBI-ProteinID: AEG60505
UniProt: F6DLF7
Position
complement(2280095..2281039)
Genome map
AA seq 314 aa AA seqDB search
MLIKNFQQVLEEVKTLPKMRISVANAQDEAVLQALKEAVKEGFAEPVLVGSRSEIERVAW
EVGFPLNGVEIWEADAMEAPEIAVKLVRNGFAQVLMKGLVNSSTFLKAVMNKDWGLRTGK
MLSHISVYQVNGYDRLLFLTDGGLNIAPDLEQKKNICQNAIDFARAVGITQPKVAILSAN
EQVNPKMPVTLEAQQLTQMAQKGEIRGALVDGPLALDIAINEKAAQHKGIKGPVAGHADI
LLVPDIEAGNMLGKSIIYFAGGIMAGLVWGAAAPVVLPSRSDTPTNKLMSLALACLAGHG
VAGQDHYFRCRQIG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgttgataaagaactttcagcaggttttggaagaggtaaagaccctgcccaagatgcgc
atcagtgtggccaacgctcaggatgaagcggtgctgcaggccctgaaggaagcggtcaag
gagggctttgccgagccggttctggtgggttcccgcagtgaaatcgaacgggtggcctgg
gaggttggctttcctttgaacggagtggagatttgggaagccgacgccatggaagctccg
gaaattgcggtaaaactagtgagaaacggctttgcccaggtgctcatgaagggtttggtg
aacagcagcacctttttgaaggcggtcatgaacaaggactggggcctgcgcaccgggaaa
atgctcagtcatatttcagtttatcaggtcaacggttacgaccggctgctttttctgacg
gacgggggattaaacattgctccagatctggaacaaaagaaaaacatttgccagaacgcc
attgactttgcccgggctgtgggaatcacgcagccgaaggtggcgattctctcggccaac
gaacaggtgaaccccaaaatgccggttaccctggaagcccagcaattgacccagatggct
caaaagggagaaatcagaggtgctctggtggacggtcctttagccttggacattgccatt
aatgaaaaggcggcccagcacaaagggattaaaggcccggtggccggccacgccgatatt
ttgctggtaccggacattgaagcaggcaacatgctgggcaagtccatcatttattttgcc
ggcgggatcatggcgggactggtctggggcgccgcagcgccggtggtgcttccctccagg
tccgatacccccaccaataagttgatgtcactggctttagcctgcctggcaggacacggg
gtggccggacaggaccattactttcgatgccgacaaatagggtaa

DBGET integrated database retrieval system