KEGG   Desulfotomaculum ruminis: Desru_3861Help
Entry
Desru_3861        CDS       T01518                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dru  Desulfotomaculum ruminis
Pathway
dru00010  Glycolysis / Gluconeogenesis
dru00030  Pentose phosphate pathway
dru00051  Fructose and mannose metabolism
dru00052  Galactose metabolism
dru00680  Methane metabolism
dru01100  Metabolic pathways
dru01110  Biosynthesis of secondary metabolites
dru01120  Microbial metabolism in diverse environments
dru01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desru_3861
   00030 Pentose phosphate pathway
    Desru_3861
   00051 Fructose and mannose metabolism
    Desru_3861
   00052 Galactose metabolism
    Desru_3861
  Energy metabolism
   00680 Methane metabolism
    Desru_3861
Enzymes [BR:dru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desru_3861
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Desru_3861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK POTRA_2
Motif
Other DBs
NCBI-ProteinID: AEG62061
UniProt: F6DQR4
Position
3929686..3930840
Genome map
AA seq 384 aa AA seqDB search
MQKQNKLFIAQSGGPTAVINSSLAGIIAAAQNSGVIAGIYGLFNGLEGALKEEIVDLTHL
SRQEIQLLRHTPAAALGGSRYIMKEEDYRQAVRFLEKQGAGHFLFIGGNGTMGTCHKLKQ
VAEEMGVAMTVNGVPKTIDNDLVGLDHAPGYASAARYVALAVKAQGADLRSMRTFEQVRI
IETMGRAVGWLAAASALAQEHPEDPPHLVYLPEVPLAINDFLEDVQKMYRRHGYVVAVVG
EGMKDVNGHPIGCEQFQNEEGTRPVIVGASEHLSKLVKSRLGLVARSQNLGMTQRSFSEC
VSLFDEEFAYECGRAAFLASMEGKKGRMIWQDGDLPLKKVAGLVQTYPNYFYDMGKKQPT
SAFHQWLSPLIGSMPSYFNIHLKD
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagcaaaataagctatttatcgctcagtccgggggccctacggcggtgatcaac
agttcgctagccggcattatcgctgctgcccagaatagcggtgtaatagcgggaatttac
ggtttgttcaacggcttagaaggggccttaaaagaggaaatcgttgatttgacccacttg
tccaggcaagaaattcaacttttacggcatacaccagccgctgccctaggcggaagtagg
tatattatgaaggaagaagattaccggcaggcagtacgctttttggaaaagcagggtgcc
gggcattttcttttcattggcggtaacggaactatgggaacgtgccataaattgaagcaa
gttgcggaggaaatgggcgttgccatgaccgttaatggagtacccaagaccatagacaat
gacttggttggcctggatcatgcccccggctacgccagtgcggcccggtacgtagcctta
gcggttaaagcccagggtgccgatttgagatccatgcgtacctttgaacaagtaagaatt
attgaaaccatgggcagggcggtgggctggctagctgccgcctcggcgctggctcaagag
catccggaagatccgcctcatcttgtctatctgccggaggtccccttagccatcaatgac
tttcttgaagatgttcaaaaaatgtatcggcgccatggctatgtggtagccgttgtggga
gaaggcatgaaagacgtaaatggacaccctatcggctgtgaacagttccagaacgaggag
ggcacccgtccggttattgtgggggcatcagagcacctgtctaaactggttaaaagccgg
ttagggctggtagcccgaagccaaaatctggggatgacccaacgcagtttctccgaatgt
gtctctttgtttgatgaagaattcgcctatgaatgcgggcgggcggccttcctggcctca
atggaaggaaaaaagggacgtatgatttggcaagacggcgatcttcccttgaaaaaagtt
gcggggttggtacagacctatccgaattatttttatgatatgggcaaaaagcagccgacg
agcgcttttcaccaatggttgtccccactaataggttccatgccctcttattttaatatt
catcttaaggactga

DBGET integrated database retrieval system