KEGG   Desulfovibrio salexigens: Desal_0013Help
Entry
Desal_0013        CDS       T00969                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00010  Glycolysis / Gluconeogenesis
dsa00030  Pentose phosphate pathway
dsa00051  Fructose and mannose metabolism
dsa00052  Galactose metabolism
dsa00680  Methane metabolism
dsa01100  Metabolic pathways
dsa01110  Biosynthesis of secondary metabolites
dsa01120  Microbial metabolism in diverse environments
dsa01130  Biosynthesis of antibiotics
dsa01200  Carbon metabolism
dsa01230  Biosynthesis of amino acids
dsa03018  RNA degradation
Module
dsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desal_0013
   00030 Pentose phosphate pathway
    Desal_0013
   00051 Fructose and mannose metabolism
    Desal_0013
   00052 Galactose metabolism
    Desal_0013
  Energy metabolism
   00680 Methane metabolism
    Desal_0013
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desal_0013
Enzymes [BR:dsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desal_0013
Protein phosphatases and associated proteins [BR:dsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desal_0013
Messenger RNA biogenesis [BR:dsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Desal_0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ACS78085
UniProt: C6BUU8
Position
10235..11572
Genome map
AA seq 445 aa AA seqDB search
MVKKANKAEQINTEIPVLGKAKIPSPLKRCVFIEDKERTLVNLAEEEMDSSSGNDVYQEF
EKAGPRAFTYFDPSKTKCAVVTCGGLCPGLNDVIRSIVLEAHYLYKVPSVLGIKFGLQGF
IPKYGHDVVELTADTVANIHQFGGTVLGSSRGPQDPEEVVDALERMNISVLFMIGGDGTM
RAAQKIVEEIEKRKIRISIIGVPKTIDNDISFVTKSFGFDTAVDKATEAIQSAHVESVGV
VNGIGLVKLMGRESGFIAAQATLALKDVNFVLVPEHPFEFDGEYGLLRSLEKRLDERQHA
VIVCAEGAGQEQCEYTGEKDASGNPVLCDVCTLIIRRIKDYFKDVGKDITLKFIDPSYII
RSVPANANDCVYCGFLGQHAVHAAMAGKTGMVVSRLQARYVHLPLNLVTIKRKKLNIKSD
YWRAVLESTGQGHLRNDMEKDICEI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaaaagctaacaaagcagagcagataaataccgagatcccggtgttgggtaag
gcgaaaattccttctccgctcaaacgttgtgtctttattgaagataaggaacgaaccttg
gtcaaccttgctgaagaggaaatggattcatcttccggcaatgatgtttatcaggaattt
gaaaaagccggtcctcgtgcatttacctattttgatccttcaaaaaccaagtgtgcggtg
gttacctgtggtggactttgccccggtctgaacgatgttatccgttcgatcgtacttgag
gcccactacctgtataaggttccttccgtactgggtatcaagttcggcttgcagggtttt
atccccaagtacggacatgatgttgtagagcttacagccgatactgtagcaaatattcac
cagttcggcggaacagttcttggttcttctcgtggtccgcaggaccctgaagaggttgtc
gatgcattggaacgcatgaacatttcagtgctgttcatgatcggcggtgacggaaccatg
cgtgcggctcagaaaattgtggaagagattgagaaaagaaaaatcagaatttccattatc
ggtgtccccaaaaccattgataatgacatcagttttgtcaccaagtctttcggttttgat
accgctgtagacaaggcaacagaagccatccagtccgctcatgttgaatccgtgggtgtt
gttaacggcatcggtctggtaaagcttatgggccgtgaatcaggctttatcgctgcgcag
gctactttggctcttaaagacgtaaactttgtgctcgtgcccgaacatccctttgagttt
gacggggaatacggcttgcttcgctctcttgaaaagcgtctggatgaacgccagcatgcg
gtcattgtctgtgcagagggagcagggcaagaacaatgcgaatacaccggggaaaaggat
gcatccggcaaccccgtgctttgtgatgtctgcactctgatcattcgccgcatcaaggac
tacttcaaggatgtgggcaaggacatcaccttgaagttcattgaccccagttacattatc
cgttcagtcccggctaatgccaacgattgcgtttattgcggtttcttaggtcagcatgca
gtacacgcagcaatggcaggaaagaccggaatggtggtcagccgtttgcaggctcgctac
gtgcacctgccgcttaatttggtaaccatcaagcgcaagaagttgaacatcaagtccgac
tactggcgtgcagttctcgaatccaccggtcagggccatctgcgcaatgacatggagaag
gatatttgtgaaatatag

DBGET integrated database retrieval system