KEGG   Desulfovibrio salexigens: Desal_0017Help
Entry
Desal_0017        CDS       T00969                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00240  Pyrimidine metabolism
dsa00250  Alanine, aspartate and glutamate metabolism
dsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Desal_0017
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desal_0017
Enzymes [BR:dsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Desal_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACS78089
UniProt: C6BUV2
Position
complement(15750..16673)
Genome map
AA seq 307 aa AA seqDB search
MEWRHKDLLDVTQLNKEEVQHIFETATYFQEINSRPVKKVPTLKGHSVVLFFAEASTRTK
TSFDMAGKRLSCDTFSLAKSSSSLTKGETLKDTALTLQAMNPDGIVLRHWASGASQFLAE
RLDCSIINAGDGRHAHPTQALLDGFTLYQEWGSLEGKTVLILGDIAHSRVARSNLILMNK
MGAKVRFCGPRTLLPPQIRKWDAEVYTDINEACKGVDAIMCLRLQLERQQDGLLPDLREY
SNYFGLGHKQIELANPDVKIMHPGPMNRGVEINSELADCEASLVLDQVASGVATRMALLY
LYLTRKK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggaatggcgacataaagatttgctggatgttacccagctcaacaaagaggaagtgcag
cacatttttgaaactgctacttactttcaggaaatcaactcccgtccggtaaaaaaggta
ccgactttaaaaggccatagcgtggtccttttttttgccgaagcaagcacaagaaccaag
acctcctttgacatggccgggaaacgtctttcctgtgacacattctcccttgccaaaagc
tccagcagtctgaccaagggcgagactctcaaggataccgccctgacattgcaggccatg
aacccggacggaattgtcctgcgccactgggccagcggtgcttctcaatttctggcagag
cgcctcgattgcagtatcatcaacgcaggtgacggccgccatgcccaccccacacaggcc
ttgcttgacggtttcacactctatcaggaatggggatctctggaaggtaagacagttctc
atcctcggtgatatcgcacacagtcgtgtagcgcgttcaaacctgatcctgatgaataag
atgggtgccaaggttcgtttctgcggccctcgcacactgctgcctccgcagatcagaaaa
tgggacgcagaagtttacaccgacatcaacgaagcctgcaaaggtgtggatgcaatcatg
tgtctccgacttcagctggaacgccagcaagacggtcttctgcctgacctgcgtgagtac
tccaactacttcggtctggggcacaaacaaattgagcttgccaatcctgatgtaaagatc
atgcatcccggacccatgaaccggggagtcgaaatcaattccgagcttgccgactgcgaa
gccagcctcgtacttgatcaggtcgcatccggtgtagctacccgcatggccttactctac
ctctacctcacccgcaaaaaataa

DBGET integrated database retrieval system