KEGG   Desulfovibrio salexigens: Desal_0092Help
Entry
Desal_0092        CDS       T00969                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00010  Glycolysis / Gluconeogenesis
dsa00620  Pyruvate metabolism
dsa00640  Propanoate metabolism
dsa00680  Methane metabolism
dsa01100  Metabolic pathways
dsa01110  Biosynthesis of secondary metabolites
dsa01120  Microbial metabolism in diverse environments
dsa01130  Biosynthesis of antibiotics
dsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desal_0092
   00620 Pyruvate metabolism
    Desal_0092
   00640 Propanoate metabolism
    Desal_0092
  Energy metabolism
   00680 Methane metabolism
    Desal_0092
Enzymes [BR:dsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Desal_0092
Lipid biosynthesis proteins [BR:dsa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Desal_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACS78163
UniProt: C6BV26
Position
97606..99474
Genome map
AA seq 622 aa AA seqDB search
MDHKETLDSLLHEERVFRPLPQMLIEAGVNPQDLRAARELAEVDLCSYWEEAAEELDWFK
KWEQVCDISDAPNYRWFSGARCNIVYNALDRHIETVNKNRLALIWEGEPGDSRQYTYYEL
YRAVNRFANGLKALGVGKGDRVVLYMPQLPETVIAMLACARIGAVHSMVFSGFSARLLRE
RVREVDPRVVVTVDGFYRNGQVIRLKEEVDRALLDDPAQNLESVVVVHRANVDVNMDSAR
DCWYEDLVRHERPHAPAEIMAADDPLFIMHTSGTTGKPKGLVHSHGGYMVGVHRTFKWVF
DLKPTDIFWCSADPGWITGHSYLVYGPLLAGTTTVMYEGHSLYPQADRLWNIVSKYGVTI
FYTSPTQIRTLMRFGHRYPEQHDLSSLRILGAVGEPFNTEAWLWMYENIGKGQCPVLDTW
WQTETGMIMISPLPVSVLKPGSVTRPLPGIDADVVDAEGNPVPDGKGGLLVIKKPWPAMF
SDVIGDREEVMAHYWKRIPGMFYAGDVARKDEDGYFWIQGRADDVLNISGHRIGTAEVEC
ALTKHPQVAEAAVVGVVDKIKGQVAKAYVTLNHGFVESDDLHRELKEQVRRELGPIVIVR
SIEFRDELPKTSSGKIKRTELG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
gtggatcataaggaaacactggacagcctgttgcatgaagagagagttttccgtcccctg
cctcagatgcttattgaggccggggtcaatccgcaggatctgcgcgcggcgcgtgaactt
gcggaagtggatctctgctcctattgggaagaagcagccgaagaactggactggtttaaa
aaatgggaacaagtctgcgatatttccgatgcacccaattatcgttggttcagcggagcg
cgttgtaacattgtctacaacgcccttgaccgtcatatagagactgtaaacaagaatcgt
ctggccttgatctgggaaggtgagccgggggattcccgccaatacacttattatgaactt
tatcgggctgtgaaccgttttgccaacggcctgaaagcgcttggcgtaggtaaaggtgac
cgggtggtcctttacatgcctcagcttcctgaaacagtgatcgccatgcttgcctgcgcc
cgtatcggtgccgtgcattcaatggttttttctggattttcagcacgactgctgcgtgag
cgtgtccgtgaagttgatccccgtgtggttgttactgtggacggtttttaccgtaacggg
caggtcatccgtcttaaggaagaggttgaccgtgcactgctggacgatcctgcacagaat
ctggaatctgtggtcgtggtccatcgggccaacgtggacgtgaacatggattccgcccgt
gactgctggtacgaggatcttgtgcgtcatgaacgtccgcacgctcctgccgagattatg
gctgccgatgatcccctgttcatcatgcatacttcgggcaccacaggaaaacccaaaggt
ttagtccattcccacggcggatatatggtcggtgtgcaccgtaccttcaaatgggtcttt
gatcttaagcctacagatattttctggtgttctgctgatccgggctggatcaccgggcac
agctaccttgtttacggccccctgctggccgggaccactaccgttatgtatgaggggcac
tccctctatccgcaggcagaccgactctggaatattgtttccaaatacggggtcacaatt
ttttatacttctcctactcagatcaggacccttatgcggttcggtcaccgctatcctgag
cagcacgacctttcttcactgcgcattctcggtgcggttggtgagccgttcaatactgaa
gcatggctctggatgtacgagaatatcggtaagggccagtgtccggtgctggatacatgg
tggcagaccgagaccggaatgattatgatcagcccgttgccggtgtctgttctgaagccc
ggttccgtgaccagacctctgccgggaattgacgctgatgttgttgatgctgaaggtaat
cctgtacctgatggcaagggtggtttgctggtgatcaagaaaccttggcctgccatgttc
agtgatgtgatcggtgatcgtgaagaggtcatggctcattattggaagcgcattccgggc
atgttctatgccggggacgttgcccgcaaggatgaagacggctacttctggattcagggc
cgcgctgatgacgtgcttaatatttcaggacaccgcattggaaccgccgaggtggaatgt
gcgctgactaagcatccgcaggttgcggaagctgctgtggttggtgttgtggataagatt
aaggggcaggttgccaaggcgtatgtgaccttgaatcatggttttgtagagtcagacgac
ctgcaccgtgagttgaaagaacaggtccgccgtgagctgggccccatcgtcatcgtgcgt
tctatcgaattcagggatgaactgcccaagacatccagcggtaagatcaagcgtactgag
ttggggtaa

DBGET integrated database retrieval system