KEGG   Desulfovibrio salexigens: Desal_0418
Entry
Desal_0418        CDS       T00969                                 

Definition
(GenBank) type VI secretion protein, VC_A0107 family
  KO
K11901  type VI secretion system protein ImpB
Organism
dsa  Desulfovibrio salexigens
Brite
KEGG Orthology (KO) [BR:dsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dsa02044]
    Desal_0418
Secretion system [BR:dsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Desal_0418
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ACS78485
UniProt: C6BX05
Position
451144..451626
AA seq 160 aa
MAKEGSVAPKERVNIVYKPDTGDAKEEVELPLKLLVVGDFTQKDDDRMVEDRDPVNIDKD
NFNEVLKAQDLELNMGVEDKLSGDSDAQMAVKLKFESLKDFDPDRIISQVPELQKLMELR
EALKALKSPLSNVPEFRKKVQELVKDDGAREKLLKELGIE
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctaaagaaggttccgtagctccaaaagagcgggtcaatattgtttacaagcctgat
accggagatgccaaggaagaggtcgagcttcctctcaaactgctggtggtcggcgatttt
acccagaaagacgatgaccgcatggtcgaggatcgtgatccggtaaacatcgacaaggat
aatttcaacgaagttctcaaggctcaggatcttgaactgaacatgggcgttgaggacaag
cttagcggtgattctgatgctcagatggcggtcaagctcaagtttgaaagtctcaaggac
tttgatccggaccggatcatcagtcaggttcctgaattgcaaaagctcatggaactccgc
gaagccttgaaagcactgaagagtccgctctccaatgtaccggaattcaggaaaaaggtt
caggaattggtcaaggatgacggcgcacgcgaaaagctgcttaaagaacttggaatcgag
taa

DBGET integrated database retrieval system