KEGG   Desulfovibrio salexigens: Desal_0435Help
Entry
Desal_0435        CDS       T00969                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Desal_0435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dsa02044]
    Desal_0435
Secretion system [BR:dsa02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Desal_0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF_C MMR_HSR1 IcmF-related DUF2530
Motif
Other DBs
NCBI-ProteinID: ACS78502
UniProt: C6BX22
Position
473582..477085
Genome map
AA seq 1167 aa AA seqDB search
MKKFLLNLLKIIFIVLLFVLAAVASYALVTYMGWPWWAGACLFGGVIGLVAAFFFIRKWM
LRRREKKFVKRIVDQDDSAIAAAPLHERSRLQELQTRWTEAVQLLQNSELRRHGNPLYAL
PWFMVFGESDSGKSTAVASSRLTSILSDVGPTPGVSATRNCDWWFFEEAVILDTAGRYAI
PIDESRDKEEWEKFLTLLVKYRKREPLNGLIITLPADRLQSGDEDSLNEYGRSLRRRVNE
LMRVLGVRFPVYVLLTKMDLVFGLKGLTEVLPDEARSQAMGMVNESMTSDPEEFVDTAVS
GVIERLRALRMTLLDRENSFDPAFLLFAEELDRLRPRIRAFADGVFEENPYQEQPLFRGI
YFSSGEQSGEQSSAFLDSLPSLQNVETKLPGTRQGLFLHDFFSKVLTRDRNLFTPIIEFL
KWKLLTRNMGMLVWLLLLFFVCGLFSMSFLGNRRALDDLFTAFPKPPEFSEKIDECVVEM
EGFRQKIVHLHDLNSNWWVPRMGLDVSLEAEQKVRKLYVEKFESALLKPVDTQLSRTIES
LHAGSSEQEVSDFVKLLGWRIDLLDNRIEGGKVKPLAPYELPSGQAMSMAVPGFESDLMK
YYGQTYSSYLDWIENDEGLKEQRLLLQARLGKVFSLKGSDFKWLVDWVDSNPEVQPVTLR
DFWGGPRLHFENEVHVPPAYTTTGHKMLTDFLGELRRAMPDNTDFAQREKDFWNWYAEQF
YRSWYSFSEHFTEGERQLLTKDDYSSMAHTMANADNPYFKLLGRMKEEFSVIKGLGTAPD
WIADLFDFNIVLTQYKAMKAKGVEESSQKAEESLRKIMADLGGKMAENIEARIEGAKQLD
EYMQVLHDLAGFTTSQETAFKSAAALYPATGQSSEGSGAESKSAGAVKKNPVDGATRAMA
ALRTRMRSGGQGTHMFWNLVAGPLEFMVYVITMEASCELQQLWEGKVLAETAHVPSDKLR
TTLFGKSGIVNKFTSSSASPFLSKGVKGWQSRQWLGIPFPFREEFFVFLNDGEQGAQEIQ
PEYKVGLSTIPTSVNSNATQEPYATTLSLECGSGRQELVNYNYSEKTTFTWKPDQCGTTT
LTIRFPGIDLVKTYEGKLGFAKFLSEFRNGEVNFSPKDFPDQAKGLQGLGVSSVKVGYNF
SGAVPVIEVLQIKPLNLPNFITDCWEN
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttctactcaatctgctcaagatcatctttattgtgctgctttttgtgctg
gcggcagtagcctcctatgcccttgttacttatatgggctggccgtggtgggccggagct
tgtcttttcggcggggtgatcgggctggttgcagctttctttttcatccgcaaatggatg
ttgcgcaggcgggagaagaagtttgtaaaacgcattgtggatcaggatgattcggccatt
gccgccgccccgctgcatgagcgttcccgcttgcaggaacttcagacccgctggactgag
gctgtgcaactgctccagaattcggaactgcgcaggcatggcaaccccttgtacgctctg
ccgtggtttatggttttcggtgaatctgattccggtaagagcactgcggtcgccagcagc
aggctgacctctattctttcagatgtagggcctactcccggagtttccgctacacgcaat
tgtgactggtggttttttgaagaggcggtcatccttgatactgccggacgttacgccatt
cccattgatgaatcacgggataaggaagagtgggagaaattcctgacactgctggtcaaa
taccgcaaacgtgagcctctcaacgggttgatcatcactctgcctgccgaccgtctgcaa
tccggagatgaagacagtctgaacgaatacgggcgcagtctgcggcggcgggtcaatgaa
cttatgcgcgtgctgggtgtgcgttttcctgtctacgtattgctgaccaagatggatctt
gttttcgggctcaaagggctgactgaggttcttcctgatgaggcccgttcgcaagcaatg
ggcatggtaaatgagtccatgacttccgaccccgaagaatttgtggatactgctgtttcc
ggtgttatcgaacgtctgcgtgctctgcgtatgaccctgttggatcgggagaacagcttt
gatcccgctttcctgctctttgccgaggaactggaccgtttacgcccgcgcatccgggct
tttgcggacggtgtgttcgaggagaatccctatcaggagcaaccgctgttccggggaatt
tatttttccagcggcgaacagagcggtgagcagagttccgcttttctggacagtcttcct
tctttgcagaacgttgaaacaaagcttccgggcactcgtcagggtttgttcctgcacgac
ttcttttccaaggtcctgacccgtgaccgcaatttgtttacccccataattgaattcctc
aaatggaagctgctcacccgcaatatgggaatgctggtctggttgttgttgctgtttttc
gtttgcggcctgttcagcatgtcctttttgggcaaccgtcgtgctctggatgatcttttt
accgccttcccgaaaccaccagagttctctgaaaagattgatgaatgtgttgtagagatg
gaaggtttccgtcagaaaatagtgcatttgcacgatttgaattcaaactggtgggttccg
cgtatggggcttgatgtcagccttgaagcggagcagaaggtccgcaaactttatgttgaa
aagtttgaatctgcattgctgaaacctgtggatactcagttgtcacgaacaattgaaagc
ttgcatgccggttcttcggagcaggaagtcagtgatttcgtcaagttgctcggctggcgc
attgatctgctcgataatcggattgaaggcggaaaagtaaagcccttggctccgtacgaa
ctaccttccggtcaggccatgtctatggctgttccggggttcgagtcggacctgatgaag
tattatgggcaaacttatagttcatatcttgattggattgaaaatgatgaagggttaaaa
gagcaaaggctgctcttgcaggcacgtctgggtaaagtcttcagtcttaagggatcggat
tttaagtggctggtggattgggttgattccaatcctgaagtgcagccggtgaccctgcgc
gatttttggggcgggccgcgactgcattttgaaaacgaggtccatgttccccctgcttac
acgaccaccggacacaagatgcttactgatttccttggggaattacgcagggcaatgccg
gataatacggatttcgcacaacgagaaaaggatttctggaattggtatgcagagcaattc
taccgctcatggtattctttttccgagcattttaccgaaggtgagcgtcagttgctgact
aaagatgattacagcagcatggctcatactatggctaatgccgacaacccttacttcaag
ctgctaggcaggatgaaagaggaattttcggtaataaagggattgggaactgccccggat
tggattgctgatctttttgatttcaacattgtgctgacccagtacaaggccatgaaagcc
aagggtgtagaagaatcttcccagaaggcagaggagtccctgcgtaaaatcatggcggat
ctgggcggcaagatggctgaaaatattgaggcccgtattgagggagccaaacagctcgat
gagtacatgcaggtgttgcatgatctggccgggtttaccaccagtcaggaaacagccttt
aagagtgcggctgctctttatcctgctaccggacagagttctgaaggcagcggggcggag
agcaagtctgccggagcagtgaagaagaatcctgtggacggagctaccagagctatggcc
gctttgcgcacccgcatgcgtagtggagggcagggcacccatatgttttggaatcttgtg
gccggaccgctggagttcatggtctacgtgatcaccatggaagcttcctgcgaattgcag
cagctttgggaaggcaaagtgctggctgaaacggcccacgtaccttcggacaagctgcgg
accactttgttcggcaaaagcggaattgttaataagtttacttcaagcagtgcttctcct
ttcctgagcaaaggagttaagggctggcaaagccgtcaatggctgggaattccttttccg
ttccgtgaagaattctttgtttttctcaatgacggagagcagggagcacaggaaattcag
cctgaatacaaggtcggattgtctaccattcctacttccgtgaattccaatgccacgcag
gagccgtacgccacaaccctatcccttgaatgcggcagtggcagacaggagttggtaaac
tataactattccgaaaagacgactttcacatggaagcctgatcagtgcggtacaaccacc
ctgaccatccgttttccgggtattgatctggtcaagacctatgagggcaagcttggtttt
gccaagttcttgtccgagttccgtaatggcgaggtcaatttcagtcccaaggattttccg
gatcaggccaagggcttgcaaggtctgggcgtaagcagtgtaaaggtcggctacaatttc
agcggtgctgttccggttatcgaggtcttacagatcaagcccttgaacctgcccaatttt
ataaccgattgctgggaaaattaa

DBGET integrated database retrieval system