KEGG   Desulfovibrio salexigens: Desal_0633Help
Entry
Desal_0633        CDS       T00969                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00220  Arginine biosynthesis
dsa00330  Arginine and proline metabolism
dsa01100  Metabolic pathways
dsa01110  Biosynthesis of secondary metabolites
dsa01130  Biosynthesis of antibiotics
dsa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Desal_0633
   00330 Arginine and proline metabolism
    Desal_0633
Enzymes [BR:dsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Desal_0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACS78699
UniProt: C6BYA8
Position
complement(689517..690356)
Genome map
AA seq 279 aa AA seqDB search
MKDLTLVFPQWQGSINNKALHKGAYALAEGIADLPAVTTVEIEPFRKLESGGPIAGLGDI
VQQLKNVLSIIEQAKPERVLMIGGDCGTELGPVSWMSRKHGDKMALIWFDAHPDLNTPET
SKSGRFQGMALSAILGSAGPEINKAMFNPLSSKQIFLAGTRSFDPPELEFMTRNKITIFG
PEEFTRDPAWLAKQIKEAGFSKVYIHLDVDAVDPLGFGHGKPAPPAGLNFGNVLKIIEEV
NSRLDICGLGITEFHPGNESGIEKAALLIEKTLPGFTTK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagatctcactcttgttttcccgcaatggcagggatcaataaataataaagcactt
cataagggggcttatgcactggcagaaggtatagcagacctccctgctgttactacggtg
gaaatcgaacctttcagaaaacttgaatcaggtggacccattgcagggctgggcgatatt
gttcagcagctgaaaaatgtcctttccataattgagcaggctaaaccggaacgtgtcctg
atgattggaggggactgcggaacagaactcggtccggtttcatggatgtcccgcaaacat
ggcgacaaaatggccttgatctggtttgacgcccatcccgaccttaacacaccggagact
tctaaatccgggcgttttcaagggatggccctttccgccattctcggcagcgcaggaccg
gaaattaacaaggcaatgttcaatccgctgagctccaaacagatattcctcgccggcacc
agatcttttgatcccccggaactggaattcatgacgcgcaacaagataactattttcgga
cccgaagaatttaccagggatccggcatggttagcaaagcaaatcaaagaagcaggattc
agtaaagtatacatccatcttgatgtggacgcagtcgaccctctcggtttcgggcatggc
aaaccagctcctccggcaggactcaatttcggaaacgtcctaaaaataatcgaagaagtg
aacagcaggctggacatatgcggactggggataactgaattccaccccggaaacgaaagt
gggatagaaaaagcagctttgctcattgaaaagactcttcccggatttaccactaagtaa

DBGET integrated database retrieval system