KEGG   Desulfovibrio salexigens: Desal_1318Help
Entry
Desal_1318        CDS       T00969                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00010  Glycolysis / Gluconeogenesis
dsa00071  Fatty acid degradation
dsa00350  Tyrosine metabolism
dsa00625  Chloroalkane and chloroalkene degradation
dsa00626  Naphthalene degradation
dsa01100  Metabolic pathways
dsa01110  Biosynthesis of secondary metabolites
dsa01120  Microbial metabolism in diverse environments
dsa01130  Biosynthesis of antibiotics
dsa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desal_1318
  Lipid metabolism
   00071 Fatty acid degradation
    Desal_1318
  Amino acid metabolism
   00350 Tyrosine metabolism
    Desal_1318
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Desal_1318
   00626 Naphthalene degradation
    Desal_1318
Enzymes [BR:dsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Desal_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DAGK_cat PFK PhnI
Motif
Other DBs
NCBI-ProteinID: ACS79380
UniProt: C6C1Y4
Position
complement(1447426..1448613)
Genome map
AA seq 395 aa AA seqDB search
MLNFQIFIPTRIVFGPGKLAELGTLPLPKGKKAMVVIGESGAMIENGYLDKVQALLAKQN
ISTVVFDNISPNPKSDQVDEAAKIAREKGIDFIVALGGGSTIDASKAIALLTTNVGKCWD
YMQAGSGGGVNPENPAAPLIAIPTTAGTGTEADQWAVINKSGGIEKISLGNDSTFPTISI
VDPELMVSVPPRTTAYTGIDTFFHAVETFLSTAHQPMSDMLALEAVHLSSHYLPMAIAEG
DNIEARTVMAWSSTAAGMCETLSRCISQHALEHALSAKYPDLPHGLGLAKLSVPYFKRLI
PESPERFEDLAMAMGYDTQQFDENMRATVFLEGLRSLLERAGFNEESLKDYGAKEEDVAE
LVEIAEQTMGKLFEFTPAKMEREDLECIMSEAIAG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgctcaattttcaaatatttattcccacccgcattgttttcggtcccggcaaacttgct
gaactcggcaccctgcccctgcccaaaggcaaaaaagcaatggttgtcatcggtgaatcc
ggtgcaatgatcgagaacggttacctcgacaaagtgcaggctctcctcgccaagcagaat
atttccacagtggttttcgataacatctcccccaacccgaaatcagatcaggttgacgag
gctgcaaaaatcgcccgtgaaaaaggaatcgactttatcgttgcacttggcggcggttcc
accattgatgcttccaaagctatcgctcttttgaccaccaacgtgggcaaatgctgggat
tacatgcaggccggttccggcggcggagttaatcctgaaaacccggcagcaccgctcatc
gccatccccaccacagcgggaacaggaaccgaagcggaccagtgggcagtgatcaacaaa
tccggcggcattgaaaaaatcagcctcggtaatgattccaccttcccgaccatctccatc
gttgacccggaactcatggtcagcgtgcccccgcgcacaacagcctataccggtatcgac
acatttttccatgcagtggaaaccttcctttccacagcacaccagcccatgagcgacatg
ctggccctcgaagcggttcacctgagcagccattacctgcccatggcaattgccgaaggc
gacaacatcgaagcccgcacagtcatggcatggtccagcactgccgcaggtatgtgcgag
actctttcccgctgcatttcccagcatgctcttgaacatgccctgagcgcaaaatatcca
gatctcccgcacggcctcggccttgccaagctttccgtgccctatttcaaacgcctgatc
ccggaaagcccggaacgtttcgaagatctcgccatggcaatgggttacgatacccagcaa
tttgacgagaacatgcgcgcaacagtcttcctcgaaggcctgcgttccctgctcgaacgg
gccggattcaacgaagaatcgctcaaagattatggtgcaaaggaagaagacgttgccgag
ctggtagagatcgcagagcagactatgggcaaactcttcgagttcacccccgctaaaatg
gaacgcgaagatctcgaatgcatcatgtccgaagctattgcgggatag

DBGET integrated database retrieval system