KEGG   Desulfovibrio salexigens: Desal_1447Help
Entry
Desal_1447        CDS       T00969                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00780  Biotin metabolism
dsa01100  Metabolic pathways
Module
dsa_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:dsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Desal_1447
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dsa01007]
    Desal_1447
Enzymes [BR:dsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Desal_1447
Amino acid related enzymes [BR:dsa01007]
 Aminotransferase (transaminase)
  Class II
   Desal_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3 OKR_DC_1 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACS79509
UniProt: C6BRR9
Position
1581963..1583228
Genome map
AA seq 421 aa AA seqDB search
MVAILGHESYFSCSAFKTSFYFLLPDFVFMIPKSFYRRIEGELTELEKSSLLRTVPEVDF
GADKELVFKGKRLLNLASNDYLGLSKDQSLATAAIKAVEQYGCGSAASRLVTGNFRLYDE
LERELAAFKEQEDSMLFTSGYAANLAIMDSFAGRRTVVFSDKLNHASILDGIRMSGARQV
RYRHNDIAHLKKRMEASKDADEKLLVTDTIFSMDGDLAYLEEIADLCDFYDTMLVVDEAH
AEGVFGSGKGIAHERGLVRRVDLHMGAFSKGFGSLGGAVSGRKDLISYLRNKGRSFVFST
ALSPAVIGANLAALRMVAEDPSRGDKLLHMSRDVKTYLESCGFDCGQSESQIIPVILGDN
ETALTARDRLIEAGIYAAAIRPPTVPEGTARLRLSLRADLTEVDLQKIKAAFGGLKAELE
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggttgctattctgggccatgagtcttatttttcctgttcagcatttaaaacttccttt
tattttttactgccggattttgtttttatgattccaaagagtttttatcgccgtattgag
ggcgaactgaccgaacttgaaaaaagttccctgctcaggacggttcctgaagttgatttc
ggtgcggataaggaacttgtttttaagggtaaaagactgcttaaccttgcttccaatgat
tacctcggactatccaaagaccaatctcttgcaacggctgcaataaaagcagtggagcag
tatggttgcggctctgctgcctcccgtctggttaccggtaattttcgcctctatgatgaa
ttggaacgcgagcttgctgcttttaaagagcaggaagattctatgctttttacatccggc
tacgccgctaatcttgccattatggatagttttgccgggcggcgtacagttgttttttct
gataagcttaaccacgccagtatcttggatgggataaggatgtccggtgcgcgtcaggtt
cgctatcggcataatgacattgctcatttgaaaaaacgcatggaagcgtcaaaggatgcg
gatgagaaactgctggtcactgatacgattttcagcatggacggcgatcttgcatatctg
gaagagattgccgatctctgcgatttttacgataccatgctggtcgttgatgaagctcat
gctgaaggagtcttcggttctggaaaaggaatagcccatgaacggggactggtccggcgt
gttgacttgcacatgggtgctttttccaaaggtttcggctcacttggcggggccgtctcc
ggtcgaaaggatttgatatcttatttacgtaacaaaggtcgttcctttgttttcagcact
gccctgtcgcctgcagtcatcggcgcgaatctcgctgccttgcgaatggttgctgaggac
ccgtctagaggagataagctgctgcatatgagtcgggatgtgaaaacttatcttgagtca
tgcggatttgattgcggtcaatcagagagtcagatcataccggtgatactcggcgataat
gagactgcgctcaccgctcgggacaggcttattgaggcagggatttatgctgctgctatc
cgtccacctaccgttcctgaaggaacagcccgtttgcgtctttcattgcgagcagattta
acagaagttgatttgcagaaaattaaggctgcgtttggcggtttgaaagcagagttggaa
aaatga

DBGET integrated database retrieval system