KEGG   Maridesulfovibrio salexigens: Desal_1705
Entry
Desal_1705        CDS       T00969                                 
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
dsa  Maridesulfovibrio salexigens
Pathway
dsa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dsa00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Desal_1705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dsa02044]
    Desal_1705
Secretion system [BR:dsa02044]
 Type IV secretion system
  Trb secretion system protein
   Desal_1705
SSDB
Motif
Pfam: Fib_alpha PSI_PsaF FAP206 Sacchrp_dh_C DUF5856
Other DBs
NCBI-ProteinID: ACS79767
UniProt: C6BT63
Position
complement(1869837..1870667)
AA seq 276 aa
MGTQKQGKHKMRSAVTFILIVVMLMNSAPASAMTVTCTNCSDKILQMLERVTNIEQLESM
YRTYAEEMMQTQQQIMMVKQNIDQYVNMVKNTIRLPFAIKNSVIRDFKQLASLTMGLRET
VADIDVLGGVYHAAYPNFNSAKELVGLPASEVNPQYYEYYSKWSGRVDEATEATFKLSGQ
QLKEISESEEFDSYIDDLLSTPEGRMQALEAANQLSSIQISEMRKLRALMAMHIQNQAQI
QQKKEKIDQIQELNSRGYFENELSKRIQALIDKKGN
NT seq 831 nt   +upstreamnt  +downstreamnt
atgggcacccagaagcaaggaaaacacaaaatgagatcagcagttaccttcattctcata
gttgttatgctcatgaactcagctccggctagcgcaatgaccgtcacctgcaccaattgt
agcgacaaaatcctgcaaatgctggagcgcgtgaccaatattgaacagcttgaatccatg
taccggacttatgctgaagaaatgatgcagacccagcagcaaatcatgatggtgaagcag
aatattgatcagtacgtcaacatggtcaagaacaccatccgcctgccctttgccattaaa
aacagtgtgatcagagactttaaacaactggcgtctcttaccatgggattacgtgaaaca
gttgcagatattgatgtgctgggtggagtttatcatgccgcttatccaaatttcaactca
gctaaagaactcgttggtcttccggccagtgaagtgaatccccagtattacgaatactac
agcaagtggtctggtcgagtagatgaagcgaccgaggccacctttaaactttccggtcag
caactcaaagagatcagtgaatcagaagaattcgattcatacattgatgatcttttgagc
actccggaaggacgcatgcaggccttagaagctgcaaaccaactctcttctatccaaatt
tcagagatgcgaaaactgcgtgccctcatggcgatgcatatccagaatcaagcgcagatc
cagcaaaagaaagagaagattgatcagattcaggagctgaacagtagaggctacttcgaa
aacgaactgtccaaaaggattcaagctctaatcgataaaaaaggaaattag

DBGET integrated database retrieval system