KEGG   Desulfovibrio salexigens: Desal_2362Help
Entry
Desal_2362        CDS       T00969                                 

Definition
(GenBank) hopanoid-associated sugar epimerase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
dsa  Desulfovibrio salexigens
Brite
Enzymes [BR:dsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Desal_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NAD_binding_4 NmrA Polysacc_synt_2 RmlD_sub_bind adh_short TrkA_N Semialdhyde_dh KR DapB_N
Motif
Other DBs
NCBI-ProteinID: ACS80418
UniProt: C6BXB2
Position
complement(2593020..2594012)
Genome map
AA seq 330 aa AA seqDB search
MNVMITGATGLIGSRLVKILSEKGFHIKALVRDKVRAQQLVKEPVEFISGDLNNESALEE
ALQGCKYLFHLAADYRLWVPDPESMTRTNVEGTRLLMHKALEEGVERIVYTSSVCVLGCN
ADGSPADEDAESTVADMISPYKKSKFLAEKVVMEMVREEGLPAVIVNPSTPVGPGDSRPT
PTGTMVLNSARDGGMFYADTGLNVAHVDDIALGHLLALEKGKIGRRYILGGDNISLKDLF
AMTARITDKPGPRFKVPQFVMYLAGFTGEVLARLGLVKNPVATMDSVRMASKKMYYSSER
AEKELGYTHRPALEAVQDAVYWFKDQQMLD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaatgatcaccggggcgaccggattgattgggtcacgtcttgtcaaaattctt
tctgaaaagggattccatattaaagctcttgtccgcgataaggtccgggcgcagcagctt
gttaaggaaccagtggaatttataagtggagatttgaataacgagtctgcacttgaagaa
gctttgcagggctgtaaatatctttttcatctggcagcggattaccgcctctgggtgccg
gacccggaaagcatgacccgtactaatgttgaaggcacgcgtttgcttatgcataaagct
cttgaagaaggtgtggagcgtattgtttacacttccagtgtttgcgtgctcggttgtaat
gctgatggtagtcctgctgacgaggacgctgaatcaactgttgcggatatgatcagtcca
tataagaaatctaaattcttagccgagaaagtggttatggagatggtccgggaagagggt
cttccggctgtgattgtgaatccctcaactccggttggtccgggagattcgcggccgact
cctacaggaaccatggtgcttaattctgctcgtgacggtggaatgttttacgctgatact
ggtctgaatgtggcccatgttgatgatatcgcccttggtcatctgcttgccttggagaag
ggtaagattggccgtagatatatccttggtggtgataatattagccttaaagatttgttt
gccatgacagcacggatcacagacaagcccggaccgagatttaaggtcccgcagttcgtg
atgtatctcgctgggttcactggagaagttttagcaaggcttggattggtcaagaatcct
gtggcaacaatggacagtgtacgcatggcatctaaaaagatgtattatagctctgagcgg
gctgaaaaagagttgggttacactcatcgtccggctttggaagcggttcaggatgcggtc
tactggtttaaggatcagcagatgcttgattag

DBGET integrated database retrieval system