KEGG   Desulfovibrio salexigens: Desal_3753Help
Entry
Desal_3753        CDS       T00969                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00030  Pentose phosphate pathway
dsa01100  Metabolic pathways
dsa01120  Microbial metabolism in diverse environments
dsa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Desal_3753
Enzymes [BR:dsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Desal_3753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C HTH_12
Motif
Other DBs
NCBI-ProteinID: ACS81798
UniProt: C6BU89
Position
complement(4199714..4201480)
Genome map
AA seq 588 aa AA seqDB search
MIRDYFRVLVVDLGSGKGNVVKVDGRNEFAGGSGLGALLFDKYGHVDRPWDDPDQPLIFS
IGPLTGLFPLMSKTVCSFKSPYHDQFAESHAGGRSALAIRFADFDALVIKGRAPRLSCLS
LGMRHLEVKDVQFLAGKDVFSTGKILRSMFPGSGHRSILRIGPAGEKLSAMACINADTYR
HFGRLGSGAVMGAKNLKGIVIQGDGSFALPENKEYSKIYGQVYEKMTATDMMSKYHNLGT
AANLDALNELESLPWRNLQATKDEKITGITGKKFADDTLLRNAACAGCPVGCIHIGFVRE
KFMEDNQYLYRQVAYDYEPIFATGSMLGVTDAFQVLGIMDEVEKGGLDVMSGGVALAWAT
EAFEKGLVSETETIVPLAFGDAEGYKKAVQYLSNAENEFYAALGKGSLVAAAKYGGEDFA
CVLGQEMAGYATGEAFYVAEGLGFRHSHLDSGGYSWDQKNDRKDADEVCDFLISDETGRA
FLTSMVSCLFGRGVYKDEVLAECLRSVGYDEIAENMELIGERVRAMRWKIRFATGYNPDE
ISIPKRYNQIKTWKGKTDPEYMEKLKNEYGRRIRELVSDEALEKLNLK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcgattacttcagggtccttgtggtcgatctgggaagcggaaaaggtaatgtt
gttaaagttgacgggcgaaacgaatttgccgggggcagcgggcttggagctttgctgttt
gataaatacgggcatgtggaccgtccttgggatgatcctgatcagccgcttattttttcc
atcggtcctttgaccggattattcccgcttatgagcaagactgtctgttccttcaagtct
ccataccacgatcagttcgccgagagtcatgcaggtgggcgttctgctctggctatccgt
tttgcggattttgatgctttggttatcaaaggacgtgctccgcgcttatcatgcctttct
cttggtatgaggcatctggaagttaaggatgtccagtttttagccgggaaagacgttttc
agtacgggtaaaatcctgcggtcaatgtttccggggtccggtcataggtctatcctgcgc
atcggtcctgccggtgagaagctctcagcaatggcttgcatcaatgctgacacctaccgt
catttcgggcggttggggtccggcgcagtcatgggggctaagaatctcaaggggatcgtg
attcagggtgacggttcttttgcgctgccggaaaataaggaatattccaaaatatacggg
caggtttacgagaagatgaccgccactgatatgatgagcaagtatcataacctcggtact
gcggctaatctcgatgcgctgaatgaattggaatctttgccttggcgtaacctgcaggcc
accaaggatgaaaagataaccggaattaccggaaagaagtttgctgatgataccctgctg
cgcaatgcggcctgtgccggatgtccggtgggttgtatccatatcgggtttgtgcgtgaa
aagttcatggaggataaccaatatctctatcgtcaggtggcttacgattacgagcccatt
tttgctaccgggtccatgcttggggtgactgacgcctttcaggtgctgggcataatggat
gaagtggaaaagggcggtttggatgtaatgtccggcggtgttgctcttgcctgggcaact
gaagcttttgaaaagggattggtcagcgagaccgaaacaatcgttcccctcgctttcggt
gatgctgaaggttacaaaaaggccgtgcaatatctcagcaatgcggaaaacgagttttat
gctgcattgggtaaaggttctctggtggcagccgcgaaatatggcggcgaggatttcgcc
tgcgtacttggtcaggagatggccggatatgctaccggggaggctttttacgtggctgaa
gggcttggtttccgtcattcccatctcgattccggcggttactcatgggatcagaagaat
gaccgcaaggatgcagatgaagtctgcgatttcctgatcagcgatgaaaccggacgggcg
ttcctgacttctatggtttcctgcctcttcgggcgtggtgtctacaaggatgaagttctt
gccgagtgcttgaggtctgtcggctatgatgaaatagctgaaaatatggagcttatcgga
gaaagagtccgggctatgcgttggaaaatacgttttgccaccggatataatcctgatgag
atcagtattcctaagcgctacaatcaaattaaaacctggaaaggtaaaaccgacccggaa
tatatggaaaaactcaagaatgagtatggtcgtaggattcgtgaattggtctcagatgag
gctcttgagaagctaaatttgaaataa

DBGET integrated database retrieval system