KEGG   Desulfovibrio sulfodismutans: GD606_07890
Entry
GD606_07890       CDS       T06784                                 

Definition
(GenBank) molybdopterin-dependent oxidoreductase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dsd  Desulfovibrio sulfodismutans
Pathway
dsd00230  Purine metabolism
dsd01100  Metabolic pathways
dsd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dsd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GD606_07890
Enzymes [BR:dsd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     GD606_07890
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: QLA12200
Position
complement(1681149..1683521)
AA seq 790 aa
MADTTTVGKSVRQKDGRPRVTGQARYYADFAFKNLLQTRILRCPYPAAGIANMDVSQAEA
LPGVRLVMTHKNYPGIFRTALHYVGDLVAAVVADDEEIAEEALELIRVEYVKKPFVLDLK
EAIAPGAPQAFEGEDNCHDWEFHAFLSDRDPHTRLFKTKTPSDYNGFGDIEKGFAEAEVV
VEQTGFRYAYCKSPAMEPRGCTAHFDGVKLQMYTHSQGLHDEKYCLAQALGVGSDKVNLV
SPFTGSSFGGKNADVLNPNMPSHYLAIAGMASLALHLPVHCGYSREEEMLCGWSRGTITD
VKIGFTKEGVLTAMDFSHWQEVGASGDKYPPKNAMLATGAVLYSRNCEHLRGKIRYVYTN
RFASVGWQGYGAPEGIFAVETTMDIAAERLGIDPLTLRKMNCMRTGDIDAGWDPLTYKSA
YISSSGIEECLDVGARHLDWKNNWRHPRHKTGRIRHGMGVAIFAMGAGRPGPGNSSEAMV
KIFPDGTAALVCAIADIGQGQHTVQCQIVAEVLGLPYSKVGLVCHDTDSTPFATLVSNSC
GTWIQGWATFEAAMDAKRQLLRLAADKLGTTPEELEIGEGGIRCIAAPDKGLTFKEAFGP
IGHYGGRHEIIGAYVNDSPHPNCLRDGRKDELYIPKEKGAQFISLDVDTETGMVSNVRVT
MVQNVGRALHPKIVEGQLLTARHGVEHAVLGDECIVDPRHGWLLNPNFIDYKHATSMDCV
VEPFVLEIPGDRSHPFGATACGEGAACPTLAAFSNAIYNATGVRLIETPFTPARILAGLG
KIQAKGRKNA
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggctgacaccacgacggtgggaaaatccgtgcgccaaaaggacggccgcccccgggtc
acgggccaggcccggtactacgcggactttgccttcaaaaacctgctgcagacccggatc
ctgcgctgcccctacccggccgccgggatcgcgaacatggacgtttcccaggccgaggcc
ctgccgggcgtccggctggtcatgacccacaaaaactatcccgggatcttccgcacggcc
ctgcattacgtgggcgatctggtggcggcggtcgtggccgacgacgaggagatcgccgag
gaggccctggagctgatccgcgtggagtacgtcaaaaagccctttgtcctggacctgaag
gaggccatcgcgccgggcgcgccccaggccttcgagggcgaggacaattgccatgactgg
gagttccacgcctttttgagcgaccgcgatccccatacgcggcttttcaagaccaagacc
ccttccgactacaacgggttcggcgacatcgaaaagggattcgccgaggccgaggtcgtg
gtggagcagaccggctttcgctacgcctactgcaagtccccagccatggagcccaggggc
tgcaccgcccatttcgacggcgtcaaactccagatgtacacccattcccaggggctgcac
gacgaaaagtactgcctggcccaggcccttggcgtcggttcggacaaggtcaacctcgtg
tcgcccttcaccgggtccagcttcggcggaaaaaacgccgacgtgctcaaccccaacatg
ccgtcccattatctggccatcgccggcatggccagcctggccctgcacctgcccgtgcac
tgcggctactcccgcgaggaggagatgctgtgcggctggtcgcgcggcaccatcaccgac
gtgaagatcgggttcaccaaggaaggcgtcctgaccgccatggacttctcccactggcag
gaggtcggggccagcggcgacaaatatcccccgaaaaacgccatgctggccacgggcgcg
gtgctgtactcccgtaactgcgagcatctgcgcgggaagatccgctacgtgtacaccaac
cggttcgcctcggtgggctggcagggctacggcgcacccgagggcatcttcgccgtggag
accaccatggacatcgcggcggagaggctcggcatcgacccgctgacgctgcgcaagatg
aactgcatgcgcaccggcgacatcgacgcgggctgggatcccctgacctacaagtccgcc
tacatctcttcctcgggcatcgaggagtgccttgatgtgggggccaggcatctggactgg
aaaaacaactggcggcatccccgccacaagaccggacgcatccgccacggcatgggcgtg
gccatcttcgccatgggggccgggcgtcccggcccgggcaactccagcgaggccatggtg
aagatcttccccgacggcacggccgccctggtctgcgccatcgccgacatcggccagggg
cagcacaccgtgcaatgccagatcgtggccgaggttttgggcctgccgtactccaaggtc
gggctggtgtgccacgacacggattccacccccttcgccaccctggtgtccaacagctgc
ggcacctggattcagggctgggccaccttcgaggcggccatggacgccaagcgccagctc
ctgcgcctggcggcggacaagctgggaaccacgccggaggaattggagatcggggaaggc
ggcatccgttgcatcgccgccccggacaagggcctcaccttcaaggaggccttcggcccc
atcgggcattacggcgggcggcacgagatcatcggggcctacgtcaacgactcgccccat
cccaactgcctgcgggacggccgcaaggacgaactctacatccccaaggaaaagggcgcc
cagttcatctccctggacgtggacaccgagaccggcatggtgagcaacgtccgggtgacc
atggtccaaaacgtgggccgggccctgcatcccaagatcgtggagggccagctgctgacc
gcccgccatggggtggagcacgcggtgttgggcgacgagtgcatcgtggacccgcgccac
ggctggctgctcaatcccaacttcatcgattacaagcacgccaccagcatggactgcgtc
gtggagccgttcgtcctcgaaattcccggggaccggtcgcacccgttcggggccaccgcc
tgcggcgagggcgccgcctgcccgaccctggccgcgttctccaacgccatctacaacgcc
accggcgtccggctcatcgagacgcccttcaccccggccagaatcctcgccggactgggc
aagatccaggccaaagggaggaaaaacgcatga

DBGET integrated database retrieval system