KEGG   Drosophila sechellia: Dsec_GM11375Help
Entry
Dsec_GM11375      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM11375-PA
  KO
K02979  small subunit ribosomal protein S28e
Organism
dse  Drosophila sechellia
Pathway
dse03010  Ribosome
Module
dse_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:dse00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dsec_GM11375
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dse03011]
    Dsec_GM11375
Ribosome [BR:dse03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    Dsec_GM11375
  Archaea
    Dsec_GM11375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S28e
Motif
Other DBs
NCBI-GeneID: 6617464
NCBI-ProteinID: XP_002041781
FlyBase: FBgn0166318
UniProt: B4IDH1
AA seq 65 aa AA seqDB search
MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGDILTLLESERE
ARRLR
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaccagttgtgtgggcacgcgtcatgaaggttctgggccgcaccggctcccag
ggtcagtgtacccaggtgaaggtcgagttcctgggcgagcagaaccgccagatcatccgc
aacgtgaagggaccagttcgcgagggcgacatcctgacccttttggaatccgaacgtgaa
gccaggaggctgcgctaa

DBGET integrated database retrieval system