KEGG   Drosophila sechellia: Dsec_GM11912Help
Entry
Dsec_GM11912      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM11912-PA
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dse  Drosophila sechellia
Pathway
dse04013  MAPK signaling pathway - fly
dse04068  FoxO signaling pathway
dse04137  Mitophagy - animal
dse04140  Autophagy - animal
dse04141  Protein processing in endoplasmic reticulum
dse04214  Apoptosis - fly
dse04215  Apoptosis - multiple species
dse04310  Wnt signaling pathway
dse04391  Hippo signaling pathway - fly
dse04624  Toll and Imd signaling pathway
dse04933  AGE-RAGE signaling pathway in diabetic complications
Module
dse_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dsec_GM11912
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dsec_GM11912
   04310 Wnt signaling pathway
    Dsec_GM11912
   04391 Hippo signaling pathway -fly
    Dsec_GM11912
   04068 FoxO signaling pathway
    Dsec_GM11912
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dsec_GM11912
   04137 Mitophagy - animal
    Dsec_GM11912
  Cell growth and death
   04214 Apoptosis - fly
    Dsec_GM11912
   04215 Apoptosis - multiple species
    Dsec_GM11912
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dsec_GM11912
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dsec_GM11912
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dsec_GM11912
Protein kinases [BR:dse01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dsec_GM11912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 6611938
NCBI-ProteinID: XP_002036455
FlyBase: FBgn0166853
UniProt: B4HWI3
AA seq 372 aa AA seqDB search
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD
LDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMM
TPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLG
TPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVM
DYEAHNTNNRTR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagctcagcaccagcactacaccgtcgaggtgggagacaccaacttcaccatc
cacagtcggtacattaacctacggcccataggatcaggtgcccaaggaatagtatgcgcc
gcttacgatactatcacccagcaaaatgtggcgattaagaaactatctcgaccattccaa
aatgtaacccatgccaagcgagcatatagggagttcaagctaatgaagcttgttaaccat
aaaaacattattggcttacttaatgcttttacgccgcaaaggaacttggaggagtttcag
gatgtctacctggtcatggagctgatggacgctaatctctgccaggtcatccaaatggac
ctggatcacgacagaatgtcctatttgctttatcaaatgttgtgcggaataaaacattta
cactcagcaggaattatccacagagacttaaagccatccaatatagttgtaaaggccgac
tgcactctaaaaattttggatttcggtctggcacgtactgcaggaactaccttcatgatg
actccctatgtggtcacccgatattacagggctccagaggtcattttgggcatgggatac
acagagaacgtggacatatggtccgtcggttgcatcatgggcgaaatgatacggggcggt
gtgctgtttcctggaacggatcatatagatcagtggaataaaattattgagcaattaggt
acaccatctccctcatttatgcagcggttacagccaaccgtccgaaactatgtggaaaat
cgtcctagatacactggatactcatttgatagacttttccccgatggcttgtttccaaat
gataataatcagaatagccgccggaaggcttctgacgctagaaatcttcttagtaaaatg
ctagtcattgatccagagcagcggatatctgtggacgaggctttgaagcatgaatatatt
aacgtgtggtatgatgctgaggaagtggatgctcccgctccggagccatatgatcacagc
gtggacgagagggaacacactgtggagcagtggaaggagctaatctatgaggaagtcatg
gactacgaagcacacaacacaaataatagaacgcggtag

DBGET integrated database retrieval system