KEGG   Drosophila sechellia: Dsec_GM12216Help
Entry
Dsec_GM12216      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM12216-PA
  KO
K17890  autophagy-related protein 16-1
Organism
dse  Drosophila sechellia
Pathway
dse04136  Autophagy - other
dse04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dse00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dsec_GM12216
   04136 Autophagy - other
    Dsec_GM12216
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dse04131]
    Dsec_GM12216
   03029 Mitochondrial biogenesis [BR:dse03029]
    Dsec_GM12216
Membrane trafficking [BR:dse04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    Dsec_GM12216
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    Dsec_GM12216
Mitochondrial biogenesis [BR:dse03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Dsec_GM12216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 6612754
NCBI-ProteinID: XP_002037257
FlyBase: FBgn0167153
UniProt: B4HZF9
AA seq 574 aa AA seqDB search
MSTEEHVWRAHVVRRLRERNRKECDNFKEIIEQNNRLIDHVAQLKADNLKISVENEQLRS
AVSTGGTGSNVAIATLEKKLLSQQEELTELHKRKGENSQMIVDLNQKVEQQRIIISEKEH
SLVEQQTNNNRLRAEVQLLHSSLEELKKLNNTMLDEHTALQLAFSSLEEKLRGVQDENRR
LLERLMQYKSKDADKLNEENESIIRYVPFRNVSAKLKRDLEDAVREPSSSSNAASSPGAA
SSQRNSSPAQFVGGLIGDEDFDEAAINGAMEAIGLDDNEYISARFTAGEIAENSRASIDT
LKATGYLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKNSTEPR
AVLSGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTLTGHSGKVMAAKYVQE
PIKVVTGSHDRTLKIWDLRSIACIETKFAGSSCNDLVTTDSLESTIINCNYLICSVRDDT
IKLLDLRKNQVISTFTNEHFKISCDFARASFNSSGLKIACGSADGAIYIWNVNGFLEATL
KGHSTAVNAVSWSPNNNLLASVGKNKRCTIYSES
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggaggagcatgtgtggcgagcgcacgtcgtgcggcgcttacgcgagcggaat
cgcaaggagtgcgacaacttcaaggagatcatcgagcaaaacaaccgactgattgaccat
gtggcgcagctgaaggcggacaacctgaagatctccgtcgaaaacgagcagctccgcagc
gctgtgtcaacaggtggcaccggctccaacgtggccatcgccaccctcgaaaagaagctg
ctcagccagcaggaggagctcacagagctacacaagcgcaagggcgagaactcccagatg
attgtggacctcaaccagaaggttgagcagcagaggatcatcatttccgagaaggagcac
agcctcgtcgaacagcaaacgaacaacaaccgattgcgcgcggaggtgcagctacttcac
tcgagtttggaggaactcaagaagctgaacaacaccatgctggacgaacatacggcgctt
caattggcatttagctccctcgaggaaaagttgaggggagtgcaagatgaaaatcggcgt
ctactggagcgacttatgcaatacaagtcaaaggatgccgacaagttgaacgaggaaaac
gagagcataattaggtacgttccattcagaaacgtttcggctaaactgaaacgtgacctc
gaagacgcggtccgtgagcccagctcgtccagcaacgccgcctcctcgcccggcgccgca
tcctcgcagcgcaactccagtcccgcccagttcgttggcggcctcatcggcgacgaggac
ttcgacgaggccgcgataaatggcgccatggaggccataggtctcgatgataatgaatat
attagcgctcgttttacagcaggcgagatcgccgagaactcgcgggcttccatcgacacc
ctgaaggccacgggctacctgggccaggccaatcccaccaagatcctcatgaagttcgag
gcccacgagaacgagtcgcacgcggtgcgctggagtcccgtggagcgcatggtggccact
ggtggcgctgatcgcaaagtcaaactttgggacattgggaaaaattccaccgaaccacgt
gcagttctaagcggtagcagtgctgggattaactccgtagatttcgattcgacaggcgcc
tacatcctgggcacctccaatgactacggagccagagtatggacagtgatggacaatcgc
ttaagacacacgctgacgggtcacagcggcaaggtaatggccgccaagtacgtccaggag
cccatcaaagtggtgaccggtagccacgatcgcactctgaagatctgggatctgcgcagc
atcgcctgcatagagacgaagttcgccggttccagctgcaatgatctcgtcaccaccgac
agcctcgaatcaacgatcatcaattgcaattacctcatatgctctgtaagagacgatact
attaaactgttagatttacgcaagaaccaagttatatccacgtttacaaacgaacacttt
aagatcagctgtgattttgctcgagcttctttcaactcgagcggcctgaagatcgcttgt
ggatcggcggatggcgctatatacatttggaatgtgaatgggttcctggaagccacactc
aagggacacagcaccgccgtaaacgcggtcagttggagtcccaacaacaacctgctggcc
tccgtgggaaagaacaagcgctgcaccatctactcggagtcatag

DBGET integrated database retrieval system