KEGG   Drosophila sechellia: Dsec_GM12408Help
Entry
Dsec_GM12408      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM12408-PA
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dse  Drosophila sechellia
Pathway
dse00062  Fatty acid elongation
dse00071  Fatty acid degradation
dse00280  Valine, leucine and isoleucine degradation
dse00310  Lysine degradation
dse00380  Tryptophan metabolism
dse00410  beta-Alanine metabolism
dse00640  Propanoate metabolism
dse00650  Butanoate metabolism
dse01040  Biosynthesis of unsaturated fatty acids
dse01100  Metabolic pathways
dse01200  Carbon metabolism
dse01212  Fatty acid metabolism
Module
dse_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dse_M00085  Fatty acid biosynthesis, elongation, mitochondria
dse_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dsec_GM12408
   00650 Butanoate metabolism
    Dsec_GM12408
  Lipid metabolism
   00062 Fatty acid elongation
    Dsec_GM12408
   00071 Fatty acid degradation
    Dsec_GM12408
   01040 Biosynthesis of unsaturated fatty acids
    Dsec_GM12408
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dsec_GM12408
   00310 Lysine degradation
    Dsec_GM12408
   00380 Tryptophan metabolism
    Dsec_GM12408
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dsec_GM12408
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Dsec_GM12408
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dsec_GM12408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Ac81
Motif
Other DBs
NCBI-GeneID: 6611826
NCBI-ProteinID: XP_002036348
FlyBase: FBgn0167345
UniProt: B4HYZ1
AA seq 783 aa AA seqDB search
MSAARFLSAVGQISRQQLLQNKCTRALPISAQLLQSRRLMSTNPAPVANKHLHTKVVNGV
LVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGMLEA
CQTAEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKL
GLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGL
QPAEQNTIEYLEKTAVQVANDLASGKLRVNREKSGLVSKIQSFVMDTDFVKNKIFDTARK
QVLKASNGLYPAPLKILDVIRAGVDKGTDAGYEAERKGFGELSATPESKGLIALFRGQTE
CKKNRFGKPERPVKTVGVLGAGLMGAGIVQVSVDKGYQVVMKDATEAGLARGIGQVQKGL
ETAVKRKRISGLERDQTLASLRPTLDYSDFKNADIIIEAVFEDIKVKHRVIKELEAVVPE
HCVIATNTSAIPITKIAAGSSRPEKVVGMHYFSPVDKMQLLEIITHPGTSKDTIAQAVAV
GLKQGKVVITVGDGPGFYTTRILSTMLSEAIRLLQEGVDPKDLDQYTKKFGFPVGAATLA
DEVGIDVGSHIAVDLAKAFGERFSGGNLEVMNDLVLAGFLGRKSGKGIFLYDGQKRGTRP
VNNDALEIVKQKYALVSKGANAPEDLTLRMVSRFINEAVLCLEEKILDSPLEGDVGAVFG
LGFPPFSGGPFRWVDQYGAGKLVSKMQSYAELYGAPFKPAQTLLDMAKDPAKKFYPKTGS
SKL
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcagcgaggtttctgagtgccgttggccaaatttcgcgacagcaattgctgcag
aataagtgcacaagagccctgcctatttcggcccagctcctccagagccgccgcctaatg
tccacgaatcccgcaccggttgccaacaaacatctccacaccaaggtggtcaatggagtg
cttgtgatcaagatcgactcacccaatgccaaggtgaattccctgggctccgaggtaagc
gatgagttcgagcgagtgatcaaggacctggagacgaatcctgccgtcaattccgccgtt
ctgatttcgggcaaaccgggctgctttgtggccggagccgacatcgggatgctggaagcg
tgccagacggcggaggaggccacgctgatctcccacggcgcccaggtgatgttcgatcgc
atggagcgcagcaagaagcccattgtggccgccatcagtggagtctgtctgggtggtggt
ctggaactcgcccttgcctgccattaccgcatcgccaccaaggacagcaagaccaaactg
ggtctgcccgaggtcatgctgggtctcctgcccggcggcggtggcacagtccgcctgccc
aagcttacctccgtgcccacggctctggatatggagctgaccggcaaacaggtgcgcgcc
gatcgcgccaagcgactgggcatcgtggatctgttggtggatcccctaggtcctggactc
cagcctgctgagcagaacaccatcgagtacctagagaagaccgccgtgcaggtcgccaac
gatctggccagtggcaaacttcgcgttaatcgcgagaaaagcggtctggtcagcaagatc
cagtccttcgtcatggacaccgactttgtgaagaacaaaatcttcgacactgccaggaag
caggtgctcaaggcctcgaacggtctctatcccgctcctctgaagattctcgatgtgatc
cgtgctggcgtggataagggaaccgatgccggttacgaggcggagcgcaagggcttcggt
gagctgtcggccacgcccgagtccaagggcttgattgccctgttccgtggacaaacggag
tgcaagaagaaccgatttggcaagccagagcgtccggttaagactgttggtgtgctggga
gctggtctgatgggcgccggaatcgtacaggtctccgtcgataagggatatcaggtggtg
atgaaggatgccaccgaagccggcctggctcgtggtattggacaagtgcagaagggtttg
gagacggctgtgaagcgcaagcgcatctctggactggagcgcgatcagactcttgccagt
ctgcggcccactcttgattacagcgacttcaagaacgcggacatcatcatcgaagctgtg
ttcgaggacatcaaggttaagcaccgtgtgatcaaggagttggaagcagtggttccagag
cactgtgtcattgccaccaacaccagcgccattcccatcaccaagatcgctgcaggaagc
tcgcgtcccgagaaggttgttggcatgcactacttctcgcccgtggacaagatgcagctg
ctggaaatcatcacccacccaggcacctccaaggacaccatcgcccaggccgtggccgtc
ggactcaagcaaggcaaggtcgttatcactgttggtgacggacctggcttctataccacc
cgcatcctctccaccatgctgtcggaagccatcagactgctgcaggaaggcgtggaccca
aaggatctggaccaatacacgaagaagtttggtttccccgtgggtgctgcgacccttgcg
gatgaggttggcattgacgtgggctcccacattgccgtcgacttggcaaaggctttcggc
gaacgcttcagcggtggaaacttggaagtgatgaacgatctggtcctggctggtttcctc
ggacgcaagtccggcaagggtatcttcctgtacgatggccagaagagaggcactcgtcca
gtgaacaacgatgccctcgaaatcgtgaaacagaagtacgctttagtctcaaagggagcc
aatgcccccgaggatctgacgctgcgtatggtgtcccgcttcatcaacgaggccgtgctc
tgtctggaggagaaaattctggacagtccgctggagggcgatgtcggagccgtttttggc
ctgggcttcccgccattctccggtggccccttccgctgggtcgatcagtatggagcaggc
aaactggtcagcaagatgcaatcctatgctgagctgtacggagctcccttcaagcccgca
cagaccctgctcgacatggctaaggacccggcgaagaagttctaccccaagactggctcc
tcgaagttgtag

DBGET integrated database retrieval system