KEGG   Drosophila sechellia: Dsec_GM12595Help
Entry
Dsec_GM12595      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM12595-PA
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dse  Drosophila sechellia
Pathway
dse00010  Glycolysis / Gluconeogenesis
dse00562  Inositol phosphate metabolism
dse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsec_GM12595
   00562 Inositol phosphate metabolism
    Dsec_GM12595
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dsec_GM12595
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dsec_GM12595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 6612312
NCBI-ProteinID: XP_002036822
FlyBase: FBgn0167532
UniProt: B4I0F0
AA seq 453 aa AA seqDB search
MLSQFYCLFLLLLHFFVGVTLSEEGECRRLNRADIEGRLSTKTPYRAIANYDETPPKYAG
CHPTRIWSIIRHGTRNPSESVILQAQNRLSEIKKRILDQTTPPICTAELKKLRQWHWMHL
NATEDEKLLVAEGEDELIELAERMQRRFPDLLPELYNPEWYYFKYTATQRTLKSAESFAT
GLFGRHRIHTVRYPPPLHEDPVLRFYKGCGKWKTDVDKNPETLVNARRFLAEPQMQSAVE
QVRSSTRLTDLQPEDVQLMYTVCAFETAWHRPRRDSGSKSSYESVWCNFFDVAALEALEF
FEDLEYYWNDGYGYELTHRIACPAIADMFAAISSSEETRPRRANATLYFTHSGTLLKLLA
HLGLARDKKPLTHKHFASERLWRTSQIDAFATNLAFLRYDCDKGKPQVLVLHQERVVRLP
GCPQDQDLCPLATLRRIYANSVDHCDRENMCRM
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgctaagccaattttactgtttgtttttgttgctcctccacttcttcgtgggcgtgacg
ttgtctgaagagggggagtgccggcggcttaatcgcgcagatatcgagggcagactgtcc
acaaagacgccctacagagcgatcgccaattacgacgaaacgccaccgaaatacgccggc
tgccatccgactcgaatttggtccatcatccgacacggaactcgaaatcccagcgaatcc
gttatccttcaggcgcaaaatcggctatcagagataaagaaacgcatactggatcagacg
acgccgccgatctgcaccgctgaattgaaaaagctgcgccaatggcactggatgcatctg
aatgccaccgaagatgagaaattactggtggccgagggtgaggatgagctgattgagctg
gcggaacggatgcagcggcgatttccggatctacttccggagttgtacaatccggagtgg
tactactttaagtatactgcgacccaaagaacgctaaaaagtgcggaaagcttcgctacg
ggcttgttcggccgtcatcgcatccatactgttcgatatccgccgcctttgcacgaggat
cctgttttgcggttctataagggctgtggaaagtggaaaactgacgtcgataagaatccc
gaaaccttggtcaacgcacgcaggttcctagcagagccgcagatgcagtcagcagtggag
caggtacggagcagcacccggctaacggatcttcagccggaggacgttcagcttatgtac
acggtgtgcgctttcgaaacggcctggcatcgcccacgtcgcgactccggctccaaatct
tcatacgaatccgtgtggtgtaacttctttgacgtggccgccttggaggcgctggagttc
ttcgaggatctggagtactattggaacgatggctacggctacgaactgactcatcgcatt
gcctgtccggcaatcgcagatatgtttgcggccattagttcctctgaggagacacggccg
cgacgggccaacgccacgctgtacttcacgcactcgggtacgcttctcaaattgctggcc
cacctgggattggcccgggacaagaagccgctgacgcacaaacactttgccagcgagcgt
ctttggcgcacaagccagattgacgcgttcgcgaccaacttggccttcctacgttacgac
tgcgataaggggaagccgcaagtcctggtgctgcaccaggagcgagtggtgcgcctgccc
ggctgcccgcaggaccaggatctctgtccgctggccacgctgcgtcgcatttacgccaat
agcgtcgaccactgcgaccgcgagaacatgtgccgaatgtag

DBGET integrated database retrieval system