KEGG   Drosophila sechellia: Dsec_GM13614Help
Entry
Dsec_GM13614      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM13614-PA
  KO
K11252  histone H2B
Organism
dse  Drosophila sechellia
Brite
Chromosome and associated proteins [BR:dse03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dsec_GM13614
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsec_GM13614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 6621672
NCBI-ProteinID: XP_002045777
FlyBase: FBgn0168545
UniProt: Q76FD7
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaacatc
accaagaacgacaagaaaaagaaacgcaagaggaaggagagctatgccatctacatttac
aaggttctcaagcaggtccatcctgacaccggaatttcgtcgaaggcgatgagcataatg
aacagctttgtaaatgatattttcgagcgaattgctgccgaagcgtctcgtctagctcac
tacaacaagcgctcgaccatcaccagtcgggaaatccaaacggctgttcgcctgcttctg
cctggagagttggccaagcatgctgtcagtgagggaaccaaggctgttaccaagtacacc
agctccaaataa

DBGET integrated database retrieval system