KEGG   Drosophila sechellia: Dsec_GM13783Help
Entry
Dsec_GM13783      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM13783-PA
  KO
K03350  anaphase-promoting complex subunit 3
Organism
dse  Drosophila sechellia
Pathway
dse04120  Ubiquitin mediated proteolysis
Module
dse_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dsec_GM13783
Protein phosphatases and associated proteins [BR:dse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dsec_GM13783
Ubiquitin system [BR:dse04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     Dsec_GM13783
Chromosome and associated proteins [BR:dse03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    Dsec_GM13783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_8 TPR_2 TPR_11 TPR_17 TPR_16 TPR_14 TPR_12 TPR_19 TPR_7 ANAPC3 TPR_9 TPR_10 ChAPs TPR_20 HrpB1_HrpK YkyB
Motif
Other DBs
NCBI-GeneID: 6611114
NCBI-ProteinID: XP_002035671
FlyBase: FBgn0168714
UniProt: B4HV36
AA seq 311 aa AA seqDB search
MREYEAAVAIFETIHKAEPCRLDYMEIYSSSLWHLQREVELSALAQDLINQDKTSPVTWC
VSGNCFSLQKEHETAIKFFKRAVQVDPDFVYSYTLLGHELVLTEEFDKAMDYFRAAVVRD
PRHYNAWYGIGTIYSKQEKYELAEIHYVKALKINPQNSVILVHIGAMQFYMKKKDLSLQT
LNTAATLDPKNPLTRFHRGSIYFSLGKYQEALRELEELKEVVPKESVVFYLIGKIHKTLG
NMDLALMHFSWATDLDPKGANNQIKDAFDSMAHPSCCPANTTALDVDLEPTSERSDDSTQ
AQQDGSYDSDY
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagtatgaggcggcggtggcgatatttgagactatccacaaggcggagccatgc
cgcttggactacatggagatatactcgtcatccctgtggcatctgcagcgcgaggttgag
ctgtcggctctcgcccaggatctgattaaccaggacaaaaccagcccggttacctggtgt
gtgtccggcaattgtttctcgctgcaaaaggagcacgaaaccgcgatcaagttcttcaag
cgggctgtccaagtggatccagacttcgtctacagctacacactgttgggccacgaactt
gtactcaccgaagaatttgacaaggcgatggactacttccgggccgcagtggttagagat
ccgcggcattacaacgcttggtacggcatcggcaccatatactccaagcaggagaaatac
gagctggctgagattcactacgtgaaggcgctgaaaatcaatccacagaactcggttatc
cttgtgcacatcggcgccatgcaattctacatgaagaagaaggatctgtcgctgcagaca
ctaaacacggccgccacgctggaccccaagaacccgcttacgcgattccatcgcggctcc
atctacttctcgctgggcaagtaccaggaggcgctacgcgaactggaagagctcaaggaa
gtcgtgcccaaggagtcggtggtgttctatctgatcggcaaaatccacaagacgctcggc
aacatggatctggcgctgatgcacttcagctgggccaccgacctggatcccaagggtgcc
aacaatcaaatcaaagatgccttcgactccatggcccatcccagctgctgtccggccaac
acaacggccctggacgttgatctggagcccacttcggagcgttccgacgactcaacgcag
gcgcagcaggacggaagctacgacagcgactactag

DBGET integrated database retrieval system