KEGG   Drosophila sechellia: Dsec_GM15240Help
Entry
Dsec_GM15240      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM15240-PA
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
dse  Drosophila sechellia
Pathway
dse00330  Arginine and proline metabolism
dse01100  Metabolic pathways
dse01230  Biosynthesis of amino acids
Module
dse_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Dsec_GM15240
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Dsec_GM15240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 PDH
Motif
Other DBs
NCBI-GeneID: 6616740
NCBI-ProteinID: XP_002041077
FlyBase: FBgn0170160
UniProt: B4IBG7
AA seq 273 aa AA seqDB search
MSAIGKIGFLGGGNMAKALAKGFLAAGLAKPNTLIASVHPADKLSLQSFQSLGVETVVNN
APVVQQSDVVFVSVKPQVVPSVLSEIQPLSSGKLFLSVAMGITLSSIESSLSPQARVIRV
MPNLPAVVCSGCSVFVRGSKATDADAEITQKLLQSVGTCEPVDESQLDVVTALSGSGPAY
VFVMIEALADGAVHMGMPRDLAYRLASQTVLGAGHMVRDSGMHPGQLKDGVTSPAGSTAA
ALRQLELSGFRAAVSGAVEQATLRCQQISGKTT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaatcggaaagatcggattcctggggggcggaaacatggccaaggctttggct
aaaggcttcctagccgcaggcctggccaaacccaataccctgatagccagcgtgcatccg
gcagataagctctccctgcagtcctttcaatccctgggagtggaaacagtggtcaataat
gcacctgttgtgcagcaatcggatgtggtcttcgtgtccgtgaaaccccaagtggttccc
tcggttttatcggagattcagccactgagctcgggcaaactattcctttccgtggctatg
ggcatcactttgtcctccatcgagtccagtttatctccacaagctcgtgtcatccgtgtg
atgcccaatctgccagctgtcgtgtgttccggctgttcggttttcgttcgcggatccaag
gccaccgatgcagatgcggagattacccagaagctgttgcaatccgtgggcacttgtgag
ccggtggatgagtcccagttggatgtggttactgctctgagcggaagtggaccggcctat
gtgttcgtgatgattgaggccttggcggatggagccgttcacatgggcatgcccagggat
ctggcctatcgtctggcatcgcaaacagtcctgggcgctggtcatatggtgcgagatagt
ggtatgcatcccggacaactcaaggatggggtcacaagtccggcgggatcgacagcagcg
gcgcttagacaactcgagctgtcaggttttcgggcagcggtgtctggagcggtggaacag
gcgacgctgagatgccagcaaatctcgggaaagacgacgtag

DBGET integrated database retrieval system