KEGG   Drosophila sechellia: Dsec_GM16615Help
Entry
Dsec_GM16615      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM16615-PA
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
dse  Drosophila sechellia
Brite
KEGG Orthology (KO) [BR:dse00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dse01009]
    Dsec_GM16615
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     Dsec_GM16615
Protein phosphatases and associated proteins [BR:dse01009]
 HAD phosphatases
  Other HAD phosphatases
   Dsec_GM16615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2
Motif
Other DBs
NCBI-GeneID: 6617371
NCBI-ProteinID: XP_002041696
FlyBase: FBgn0171528
UniProt: B4ID86
AA seq 304 aa AA seqDB search
MCTFGCRTCKSQTDCDGCSPTCCSPCISYCIFDLESAVFDTRHVYRKALKELVRCYDKRI
PDILHVQSGPMTISEMSELFCRKLDIPMSWESFRYELNERTSQLIANPPFMDGIERLVPH
LRNSCMESGLITSSNEANYCSKIRGREDFFENFSTVVCADDPELHAPKPEPDVYLIAMSR
LGDAGPDCTLVFDGTPKGVQAASDARLPVIMLAEKDLPCCWSELAALRFEYLDDFEPEMY
NLPPFTDPAPKRRSSRRRTRYSQRLTVIRARAAEAAAAEEEEAEEEPAEPPAPAALPSIL
NLRE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtgcacttttggctgcaggacatgcaaatctcaaacagattgtgatggctgttctcca
acgtgctgcagtccttgtatcagctactgcattttcgatctagaaagtgctgtctttgat
actcgccacgtctaccggaaggctctcaaggaactggttcgttgttatgataagaggata
ccagacattttacatgtccagagtggtcctatgacgatatcggagatgtctgaactgttt
tgccggaagctcgatattccgatgagttgggaatcgtttcggtatgaacttaacgagcgg
acctcccaattaattgcaaatcccccgtttatggatgggattgagcggctggttccgcac
ctgcgcaatagctgcatggaatcgggcttgatcacatccagcaacgaggccaactactgc
tcgaagattcgcggccgggaggacttcttcgagaacttctccaccgtggtctgtgcggat
gatccggaattgcatgcgcccaagcccgagcccgacgtctacctgattgccatgtcgagg
ctaggggatgctggacccgattgcaccctggttttcgatggcactcccaaaggagttcag
gcggcgagcgatgctcgtctgcccgtcataatgttggccgagaaggaccttccctgctgt
tggtccgaattggccgccttgcgattcgagtacctggatgacttcgagccggagatgtat
aatttgcccccgtttacggaccctgcgcccaagaggcgatcgagtcgtcggcgcacgaga
tacagccagagattgactgtaatccgggccagagcggccgaagcagctgccgcggaggag
gaggaggcagaggaggaacccgcggaaccaccagcaccagccgccctaccatccatttta
aatttaagagaatga

DBGET integrated database retrieval system