KEGG   Drosophila sechellia: Dsec_GM16686Help
Entry
Dsec_GM16686      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM16686-PA
  KO
K20027  palmitoyltransferase ZDHHC1/11 [EC:2.3.1.225]
Organism
dse  Drosophila sechellia
Brite
KEGG Orthology (KO) [BR:dse00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dse04131]
    Dsec_GM16686
Enzymes [BR:dse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dsec_GM16686
Membrane trafficking [BR:dse04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    Dsec_GM16686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF3112
Motif
Other DBs
NCBI-GeneID: 6617224
NCBI-ProteinID: XP_002041551
FlyBase: FBgn0171599
UniProt: B4ICU1
AA seq 662 aa AA seqDB search
MSTTASGLKSGSKGAYGVRSETDHIITISTASLTESHRENPVKGVVTPVRKPHSLGSEDS
PENIIPGEQAEPDKKPLHLCRLSQLVSYQSNIADVQHRKGRRLHGLQLPLHPLQLFGWLV
LLLFGVASYWVLIPAFHARIQGLLYGLITGLYLVHIASHLTALLTDPADKELRRVHRNDR
IVPEFDRSKHSHVIENGRCHLCNIRTSSSRTKHCSVCNKCVGKFDHHCKWLNHCIGSRNY
VAFLMCVVSAVVATLVIVAAVVAQIVFYYIQPDWLSFYWCPTDSSHTIESGDFINITLSL
GNGTMMLIEQHTSEEDVHQEMWDEEQANMTISTLPTLLENFTALIEASSTQPGISPTNHT
VTQPVVTGIGLNETIFLFLLGVLGLLAAVSAGLLLHLCFFHIYISFLGLTTYEYIRNHRQ
AQDAKTKQLLEGAPGVGAPKNGNVHFSASLPEPHNPSKSLPGGQQLYCCSSAPHPSQHSQ
ESVGQTEQSLRLHCCASSREFHQSGQAIYVCSLLEEAVPQIQVEPDTLSSFHCCSSFAAS
SLQRRVSLAKGSLISAEPRHLRPATYLQYTEQCTLCTFRLRRGSGPGTGSSGAPLRHHHQ
NLANSNSNPAKAMSSPTLTRNSGSANSSALLVQNLCSLAGETLRKTASNSSLQSLSSNSS
ST
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaacagcatctggactaaagtcgggatccaaaggagcctacggcgtcaggtcg
gagacggatcacatcataaccatcagcactgccagcttgacggagtcgcacagagaaaat
cccgtaaagggagtagtgactccagtaaggaagccccattccctgggaagtgaagattcc
ccagaaaacataattcccggtgaacaggctgagccagataaaaaacccctgcacttgtgt
cggctctcgcagctggtgagctaccagagtaacatcgctgatgtccagcaccggaaggga
agacgcctacacggattgcagctgccactgcatcccctccaactttttggttggctcgtc
ctcctcctgtttggagtggctagctactgggtgctcattccggcctttcatgcccgcata
caaggactgctctacggactaatcaccgggctctatctggtgcacatcgcctctcatttg
acggctttactgacagatcctgcggacaaggagttgcggcgagtgcatcggaacgatcgg
attgtcccggaatttgaccggtcgaagcacagtcacgtgatagaaaacgggcggtgccat
ctgtgcaacatccggacctcttcgagccgcaccaagcactgctccgtgtgcaacaagtgc
gtgggcaagtttgatcaccactgcaagtggctgaaccactgcatcggatcgcgtaactat
gtggccttcctgatgtgcgtggtcagcgctgtggtggccaccctggtcatcgtggccgcc
gtggtggcccagatcgttttctactatatccagccagactggttaagcttctactggtgc
cccacggattcgagccacacaattgaaagcggcgacttcataaacatcaccctaagcctg
ggcaacggcaccatgatgctgatagagcagcacacttcggaggaggacgttcatcaggaa
atgtgggacgaggagcaggcaaatatgaccatctcgactctgcccactcttctggagaat
tttacagctcttatagaagcgagctcaacgcagcctggaattagccccacgaatcacacc
gtaacgcagccagtagtgaccggaatcggattaaacgaaaccattttcctgttcctgctg
ggagttctgggactgctcgccgctgtgagtgcgggtttgttgctccacctatgctttttt
cacatctacatctcgttcttgggactgaccacctatgaatacattaggaaccaccgtcag
gctcaggatgccaagaccaagcagcttctggagggagctcccggcgtgggggcgcccaaa
aatggaaacgtacacttctcggcttcattgcccgagccacataatccgtccaagtccttg
ccaggaggtcagcagctctactgctgttccagtgccccacatccaagccagcattcacag
gaatcggttggtcaaacagagcaatccctgcggttgcattgctgtgccagctccagggag
ttccaccagagcgggcaggccatctatgtttgctcgcttctggaggaggcagtaccgcaa
atccaagttgaaccggatactctgagtagcttccattgttgctctagctttgcagctagt
tccctgcagcgcagggtcagcttggctaaaggatcgctgatctcagccgagccacgtcat
ctgagaccagcgacttatctgcaatacaccgagcagtgtaccctctgcactttccgccta
agaagaggatcaggaccagggacaggatcttcaggagctcccctgaggcaccaccaccag
aatctagccaactcgaactccaatccggccaaagccatgtcctcgcctacgcttactcgc
aactcaggatctgcgaactcctcggcacttctagtccagaatctgtgcagcttggccggg
gaaacgctgaggaagaccgcgtccaacagttccctgcagagtctcagctccaattcgagc
agcacctag

DBGET integrated database retrieval system