KEGG   Drosophila sechellia: Dsec_GM17970Help
Entry
Dsec_GM17970      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM17970-PA
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
dse  Drosophila sechellia
Pathway
dse00562  Inositol phosphate metabolism
dse01100  Metabolic pathways
dse04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dsec_GM17970
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Dsec_GM17970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dse01009]
    Dsec_GM17970
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     Dsec_GM17970
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     Dsec_GM17970
Protein phosphatases and associated proteins [BR:dse01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    Dsec_GM17970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase DSPc 3-PAP Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 6613567
NCBI-ProteinID: XP_002038035
FlyBase: FBgn0172877
UniProt: B4I1P6
AA seq 416 aa AA seqDB search
MWRATKLNESYAICDSYPAVWAVPKAASDDFLRRVAQFRSRCRLPVLSWMNPRTQATITR
CSQPLVGVSGKRNSDDEAYLSFIMEANAQSDKLTIMDARPSANAIANKAKGGGYESEDAY
KNVEINFLDIHNIHVMRESLRKVKEACFPTTDDSKWQTAIDNTLWLKHIRCILAGAVRIV
DKVETMSTSVVVHCSDGWDRTAQLTALSMLLLDPHYRTVRGFEVLIEKEWLSFGHKFQQR
IGHGDNKHSDADRSPVFLQFIDSVWQVSQQFNNAFEFNEHFLITIVDHLYSCRFGTFLCN
TEAERVAEDLKHKTTSLWTHINSSLDQYLNPLFPSFTHGAELVLRPIASVRSVRLWKGLY
CRWNPGLCAPQHGCQRTRELLSKQDQLFKLVNELRLKSNNRSNSMQTTTRLASPMH
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgggcgaccaagctaaacgagtcctacgcaatttgcgacagctatccggccgtg
tgggctgtgcccaaagcggcctccgatgatttcctgaggcgcgtggcacagttccgctcg
cgctgccgtctgccggtgctgtcctggatgaacccacggactcaagcgaccattacgagg
tgctcccagccgctggtgggtgtgagtggcaagcgaaactccgacgatgaggcataccta
agctttatcatggaagcgaacgcccagtcagacaagttgaccatcatggatgcgcgacca
agcgctaatgcgattgctaacaaggccaagggcggcggttacgagtcggaggacgcgtat
aagaacgtggaaatcaacttcctcgacattcacaacatccacgtgatgcgggagagcctt
cgcaaagtgaaggaggcttgcttccccaccaccgatgactcaaagtggcagacggctatt
gacaacacactgtggctgaagcacattcggtgcattctggccggtgccgtgaggatcgtt
gacaaggtggagaccatgagcacctccgtcgtagtgcactgctccgacggctgggatcgc
acagcccagctgacggccctttccatgctgctgctcgatccgcactatcgcacagtgcgc
ggtttcgaggttctcatcgagaaggagtggctctcttttggccacaagttccagcaacgc
attggtcacggcgacaacaagcactcggatgcagacagatcgccggtgttcctgcaattc
atcgatagcgtctggcaggttagccagcagttcaacaacgcgtttgagttcaacgagcac
ttcctgataactatcgtggatcacctgtactcgtgccgcttcggcaccttcctctgcaac
acggaggccgagcgtgtggccgaagatctcaagcacaagacaacatccctgtggacgcac
atcaactcttcgctggatcagtatttgaatccactctttccatcgttcacgcacggagcc
gagctagtgctgcgtcccattgccagcgtgagatcggtccgcttgtggaagggcctatac
tgtcggtggaatcctggtctgtgcgctcctcagcatggctgccagcgcacccgcgaactg
ctatccaagcaggaccagctctttaagctcgtcaacgagctgcggctcaagtcgaacaac
cgcagcaacagcatgcagacaactacgcgactggcctcgcctatgcactaa

DBGET integrated database retrieval system