KEGG   Drosophila sechellia: Dsec_GM19865Help
Entry
Dsec_GM19865      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM19865-PA
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dse  Drosophila sechellia
Pathway
dse00450  Selenocompound metabolism
dse00970  Aminoacyl-tRNA biosynthesis
dse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dsec_GM19865
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dsec_GM19865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dse01007]
    Dsec_GM19865
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dse03016]
    Dsec_GM19865
Enzymes [BR:dse01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Dsec_GM19865
Amino acid related enzymes [BR:dse01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Dsec_GM19865
Transfer RNA biogenesis [BR:dse03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dsec_GM19865
 Prokaryotic type
   Other AARSs
    Dsec_GM19865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 tRNA-synt_1 GST_C_3 GST_C_2 GST_C Anticodon_1 GST_C_6 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 6609867
NCBI-ProteinID: XP_002034518
FlyBase: FBgn0174751
UniProt: B4HP29
AA seq 1022 aa AA seqDB search
MIIYTNEGNPLGLQLLMLAKFAKRPVQVQLVNLNDAKYKDLLVLPTLELDNGLRLFSPAA
IAKYLLVGEGQQRDEWLEWSATLLAPALAHHMAVGHKADANALPVLNALVKKLDDKLKAT
PYLTGDKPSAADIAIWSLLAPDGTLKGAQNVDNLRDWYGRVKAIPEVQEVLAEQPLKDLS
FNALQQSNRYGGLHHVPLKRLSLADASKLLVDTTPTVADTVTNEEISAAKAAFTYTAPKE
IKEERTVLPKPGERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLFICG
TDEYGTATENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAF
KDVLKAGYIITESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNAT
ELIRPRCKVCNTAPVLRSSDQLFIDLPKAEPQLKDWVDKSEGGWTHNAKVITRAWLKEGL
KPRCITRDLKWGIPVPHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVEL
FQFMAKDNVPFHSVVWPSVLLAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQ
ETGIPADVWRFYLASARPEGQDSSFSWNDLAVRNNSELLNNLGNFVNRALVFCEKNFSST
VPEVITTQDELVLLALINRELRGYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQPWNLL
KGTDDQKKRASTIIGLCVNIACLLANLLFPYMPTTARTLFGQLNAKQTPLNAEKPFVTLL
LPAGHIIGKPSPLFAKLEQSFIDELKGKYGGAQDTNAVDQSQISAADLEKAVQAQADKVR
ELKASTKDKAVWQPEVTKLLDLKKQLEEAKKKTAAAAAPTATPAPSNGSQSVQALEKAIQ
EQGDKVRKLKGSTKDKAVWQPEVNILLDLKKQLEAAQKAAKAAPAANAAPAASPAAPAAA
AQVKALEDKIAQQAEKVRTLKATGDAALWKPEVDILLSFKNELAALTGTPAAGGQGKGKK
KK
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgataatctacacgaatgagggtaacccgctgggactgcagctgctaatgctcgccaag
ttcgccaagcggccggtgcaggtgcagttggttaacctaaatgacgccaagtacaaggac
ttgctggtgctgcccactttggagctggacaacggattgcgtctgttctcgccggcggcc
attgccaagtaccttctcgtgggcgaggggcagcagcgcgatgagtggctggaatggtct
gccacgttgctggccccggctttggcccaccacatggctgtgggccacaaggcagacgca
aacgcgctgcccgtgctgaatgccctggtcaagaagctggatgacaagctgaaagctaca
ccctacctgactggcgacaaacccagtgccgccgacatcgccatttggtcgctccttgct
cccgatggcacactcaaaggtgcacagaacgtagacaacctgagggattggtatgggagg
gtgaaagccatacccgaagtgcaggaagttcttgccgaacagccactgaaggatctcagc
tttaatgcgcttcagcagtcaaatcgctatggtggtttgcatcacgtaccattaaaacgt
ctcagtctggcggatgcaagcaaactgcttgtggatactacgccaacggtggcggataca
gttacgaatgaggaaataagcgcggcaaaggctgcctttacttacacagctccaaaggaa
atcaaggaggagcgaactgttcttcccaagcccggtgagcgtaacgtgctcatcacctcc
gcgcttccttatgtcaacaatgtgccacatttgggcaacatcattggttgtgttctctcc
gctgatatctatgctcgttactcgcgttctgctggctacaacacactctttatttgcggc
acggatgagtacggtacggccaccgagaacaaggcactggcggagaaccttactcctcgt
gagatctgcgacaagtacttcgaactgcataacgccatataccgctggttcggcattggc
tttgattactttggacgcaccacaacccaagagcaaacagacattgtgcaggaggcattt
aaggatgtcctcaaagctggctacatcatcacagagagtgtggagcagttgctttgccaa
aagtgcgatcgtttcctggctgatcgttttgtcgagggtacttgcccgcatcctggctgt
ggctatgaggatgcccgcggtgatcagtgcgacaagtgcggaaagctggtcaacgccact
gagctgatccgtcccagatgtaaggtgtgcaacactgccccagtgctgcgttcctccgat
cagttgttcatcgatctgccaaaggcggaaccacaactcaaggattgggttgataagtca
gagggaggatggacgcataacgccaaggtgatcacaagggcgtggttgaaggaaggcctc
aagccgcgttgcattacacgcgacctgaagtggggcattcccgttccacacgagggcttt
gagaaaaaggtcttctatgtgtggtttgatgctccatttggatacgtgtccatgaccaag
cgctacacgaaggagtaccagcagtggtggcagccggccaagggaacagacgtcgagctc
ttccagttcatggcaaaggacaacgtgcccttccactcggtggtgtggcccagtgtccta
ctggccatcaacaagggacatacacttgtatcgcacatcatggcaaccgagtatttgaac
tacgaggacggcaagttcagcaagagtcggggtattggcgtattcggcaacgatgcccag
gaaactggcattccagctgatgtttggcgattctacttggcctctgcgcgtcctgaaggt
caggactccagcttcagctggaatgatctcgctgtccgaaataactccgagctgctgaat
aacttgggaaactttgtcaaccgcgccttggtcttctgcgaaaagaatttcagcagcact
gttcccgaagtgatcaccactcaggatgaacttgttctgcttgcgttgataaaccgagag
ctgcgtggttacattaactccatggagaaggccaaacttcgggatggcgttcgtcatttg
ctggccatttcccgacatggcaatggatacatgcaaagccaacagccttggaatctactc
aagggcactgatgatcaaaagaagcgagcgtctacgataattggtctctgtgtcaacatc
gcctgcctcttggcgaacctcctcttcccctacatgccaaccacggccaggactctcttt
ggccagcttaacgcaaaacagacgccgctcaatgctgagaaaccatttgtcactttgctt
ctgcccgccggtcacataatcggcaaaccatctccgctttttgccaaactggagcagtcc
ttcatcgacgaacttaagggcaagtatggtggagctcaggacacaaatgctgttgaccag
agtcaaattagcgctgctgatttagaaaaagccgtgcaagctcaggccgataaagtgcgt
gagctgaaggcaagcaccaaggataaggccgtgtggcaaccggaggtgaccaaactgctg
gaccttaagaaacagctggaagaggctaagaagaagactgcagctgccgccgcgcctacc
gcgactccagcaccatcgaatggatcacaatcagttcaggctctggagaaggctatccaa
gagcagggcgacaaagtgcgcaaacttaagggcagcacaaaagacaaagcagtgtggcag
ccggaggtaaatatcctgctggacctcaaaaagcaactggaggcggctcaaaaggcggca
aaggcagctcccgcagcaaatgcagctcctgctgcttcacccgccgccccggctgctgct
gcccaggtgaaggcattggaagacaagattgcccagcaggccgaaaaggttaggacactg
aaggccactggcgatgccgcactgtggaaacccgaagttgatattctgttgtccttcaaa
aacgagctggcggcgctgactggaacaccagccgctggtggacagggcaagggcaaaaag
aagaagtag

DBGET integrated database retrieval system